SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6ND01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A6ND01
Sequence length 250
Comment (sp|A6ND01|JUNO_HUMAN) IZUMO1 receptor protein JUNO {ECO:0000303|PubMed:24739963} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=IZUMO1R OC=Catarrhini; Hominidae; Homo.
Sequence
MACWWPLLLELWTVMPTWAGDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTT
SWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPS
GQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFP
TPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASSAPSWELSYTIM
VCSLFLPFLS
Download sequence
Identical sequences A6ND01 J3KNP7
gi|312836827|ref|NP_001186135.1| NP_001186135.1.87134 NP_001186135.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]