SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6NNL5 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A6NNL5
Sequence length 157
Comment (sp|A6NNL5|CO061_HUMAN) Uncharacterized protein C15orf61 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=C15orf61; OC=Catarrhini; Hominidae; Homo.
Sequence
MEALRRAHEVALRLLLCRPWASRAAARPKPSASEVLTRHLLQRRLPHWTSFCVPYSAVRN
DQFGLSHFNWPVQGANYHVLRTGCFPFIKYHCSKAPWQDLARQNRFFTALKVVNLGIPTL
LYGLGSWLFARVTETVHTSYGPITVYFLNKEDEGAMY
Download sequence
Identical sequences A6NNL5 G3QPX7 K7C9F6
ENSP00000342254 ENSGGOP00000004634 ENSP00000342254 ENSGGOP00000004634 gi|221219008|ref|NP_001137408.1| 9606.ENSP00000342254 ENSP00000342254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]