SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6U9B5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6U9B5
Domain Number 1 Region: 13-358
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.55e-85
Family Tandem AAA-ATPase domain 0.0000132
Further Details:      
 
Domain Number 2 Region: 547-806
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.12e-53
Family Tandem AAA-ATPase domain 0.00000199
Further Details:      
 
Domain Number 3 Region: 804-1012
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.85e-43
Family Tandem AAA-ATPase domain 0.00000118
Further Details:      
 
Domain Number 4 Region: 1016-1165
Classification Level Classification E-value
Superfamily TRCF domain-like 3.92e-40
Family TRCF domain 0.00019
Further Details:      
 
Domain Number 5 Region: 495-570
Classification Level Classification E-value
Superfamily CarD-like 9.42e-20
Family CarD-like 0.00036
Further Details:      
 
Domain Number 6 Region: 392-492
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.29e-17
Family Tandem AAA-ATPase domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A6U9B5
Sequence length 1171
Comment (tr|A6U9B5|A6U9B5_SINMW) Transcription-repair-coupling factor {ECO:0000256|HAMAP-Rule:MF_00969} KW=Complete proteome OX=366394 OS=Sinorhizobium medicae (strain WSM419) (Ensifer medicae). GN=Smed_1399 OC=Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
Sequence
MTMIPGLDPRKVLAATREMTIGPVPTGAEALVLAELARGGAPVAYILSDGQKVSDLEQVL
GFVAPDIPVLTLPGWDCLPYDRVSPSADTSARRLAALSALIAHRRKPHPAIVLVTVNAVL
QRISPQDVIESLAFTARPGNQIRMDDLAARLERNGFERVPTVREMGEFAVRGGILDVYVP
GSGEPLRLDFFGDTLEAIRAFDPASQRTIGQVRSLDLNPMSEVSLTPETISHFRKQYLSL
FGAATRDDALYQAVSEGRRYAGMEHWLPLFYDRLETVFDYLNGFRIVTDHLAREAAAERS
KLILDYYDARLASASPGKSQATQGTPYKPVPPDMLYLAAKAFGDALTERNAVRLSPFSEH
EGEARHVVHIEARQGVRWAKSASEAESDGTRTNVFDQAVKHIAEKRAKGARVLVSGWTEG
SLDRLLQVLGEHGLANIRPVQALSDLNSLRPGEAASTVLSLEAGFESGDLVVIGEQDILG
DRLVRRSKRRKRGSDFIAEVTGLDEGSYVVHAEHGIGRFVGLQTIEAAGAPHDCLELVYA
DDAKLFLPVENIELLSRYGSEGTDAVLDKLGGVAWQARKAKLKKRLLDMAGGLIRIAAER
HTRHAPVLAAQDGVYDEFAARFPYDETEDQLNSIDAVRDDLGSGRPMDRLVCGDVGFGKT
EVALRAAFIAAMNGVQVAVVVPTTLLARQHFRTFSERFRGLPIRIQQASRLVGSKELALT
KKEVAEGKTDIVVGTHALLGSSIKFANLGLLIIDEEQHFGVKHKERLKELKTDVHVLTLS
ATPIPRTLQLALTGVRELSLITTPPVDRMAVRTFISPFDALVIRETLMREHYRGGQSFYV
CPRVSDLPEIHDFLKSDVPELKVAVAHGQMPATELEDIMNAFYEGRYDVLLSTTIVESGL
DVPTANTLIVHRADMFGLAQLYQLRGRVGRSKVRAFSLFTLPVNKTLTGPAERRLKVLQS
LDTLGAGFQLASHDLDIRGAGNLLGEEQSGHIKEVGFELYQQMLEEAVAELKGEEEIRDT
GWSPQISVGTPVMIPEDYVPDLNLRLALYRRLGELTDLKEIDGFGAELIDRFGPLPTEVQ
HLLKIVYVKSLCRTANVEKLDAGPKGVVVQFRNKEFPNAAALVGYIAKQGTIAKIRPDQS
IFFQRDLATPEKRLSGAAMVMTQLAALAKAA
Download sequence
Identical sequences A6U9B5
WP_011975555.1.29075 WP_011975555.1.31871 WP_011975555.1.61285 WP_011975555.1.7720 WP_011975555.1.89664 YP_001327080.1.44884 366394.Smed_1399 gi|150396613|ref|YP_001327080.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]