SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8K010 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8K010
Sequence length 186
Comment (sp|A8K010|CF176_HUMAN) Putative transcriptional regulator encoded by LINC00473 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=LINC00473; OC=Catarrhini; Hominidae; Homo.
Sequence
MELSAAAGRRRQAPWREFTGRHRTERSQERGSTPRKERSMGSRQPRKREREPRDCTPTCT
NAASVSRSGARRAPGCAGRCITMKNCARAWRELSERACCFQAVPPSNMKQSWLIFLDTTL
CSAWLLASSCPRLYAPLISFHCMCFNTVLLFPRLFGPTLSAKIQFNTDLSLRAIAWKCTK
DTTTYC
Download sequence
Identical sequences A8K010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]