SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8MQ14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8MQ14
Domain Number 1 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.27e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 653-710
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 569-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 4 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.3e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 5 Region: 3-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.41e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 6 Region: 877-934
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.78e-24
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 7 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-23
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 8 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.2e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 9 Region: 989-1046
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.96e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 10 Region: 821-878
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.66e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 11 Region: 933-990
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-22
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 12 Region: 765-822
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.27e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 13 Region: 709-766
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 14 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-19
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 15 Region: 1035-1087
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 16 Region: 308-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000117
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 17 Region: 616-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000253
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 18 Region: 392-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000391
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 19 Region: 532-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000565
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 20 Region: 224-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000597
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Weak hits

Sequence:  A8MQ14
Domain Number - Region: 150-176
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0179
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8MQ14
Sequence length 1090
Comment (sp|A8MQ14|ZN850_HUMAN) Zinc finger protein 850 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF850; OC=Catarrhini; Hominidae; Homo.
Sequence
MNMEGLVMFQDLSIDFSQEEWECLDAAQKDLYRDVMMENYSSLVSLGLSIPKPDVISLLE
QGKEPWMVSRDVLGGWCRDSEFRCKTKDSCLPKEIYEVTSSQWVRMEKCHSLVGSSVRDD
WECKGQFQHQDINQERYLEKAIMTYETTPTFCLQTSLTLHHRIHPGEKLYKSTECMAFKY
GSELTQQQETHTGEKLYKCKECGKAFHHFSYLVKHQRIHTGEKPCACKEYGKAFISGSHL
IQHQKMYTDERPHECQESVKAFRPSAHLIQHWRIHTGDKPYECKECGKSFTSGSTLNQHQ
QIHTGEKPYHCKQCGKSFTVGSTLIRHQQIHTGEKPYDCKECGKSFASGSALIRHQRIHT
GEKPYDCKECGKSFTFHSALIRHQRIHTGEKPYDCKECGKSFTFRSGLIGHQAIHTGEKP
YDCKECGKSFTAGSTLIQHQRIHTGEKPYDCKECGKSFASGSALLQHQRIHTGEKPYCCK
ECGKSFTFRSTRNRHQRIHTGEKPYNCKECGKSFASGSALLQHQRIHTGEKPYHCKECGK
SFTFRSGLIGHQAVHTGEKPYDCKECGKSFTSRSALIQHQRIHTGEKPYHCKECGKSFTV
GSTLLQHQQIHTGEKPYDCKECGKAFRLRLRLTQHQQIHTGEKPYQCQECGKAFVSVSGL
TQHHRIHTGEKPYECPDCGKAFRQRTYLNQHRRIHTGEKPYECKECGKSFTFCSGLIQHQ
QNHTDEKPYDGKECGKSFTSHSTLIQHQQIHTGEKPYDCKECGKSFTSHSTLIQHQQIHT
GEKLYDCKECGKSFTSHSTLIQHQPLHTGEKPYHCKECGKSFTLRSALIQHRPVHTGEKR
YSCKECGKSFTSRSTLIEHQRIHTGEKPYHCKECGKSFAFRSAIIQHRRIHTGEKPYDCK
ECGKAFRRRSKLTQHQRIHTGEKPYRCHECGKAFVRFSGLTKHHSIHTGEKPYECKTCGK
SFRQRTHLTLHQRIHTGDRPYECKECGKSFTCGSELIRHQRTHTGEKPYDCKECGKAFRC
PSQLSQHKRIHTGEKTYQCPECGKAFFYASGLSRHQSVHTGEKPYECKTCGKAFKQLTQL
TRHQRIHDLT
Download sequence
Identical sequences A8MQ14
gi|302148470|ref|NP_001180481.1| ENSP00000464976 ENSP00000464976 ENSP00000464976 NP_001180481.1.87134 NP_001180481.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]