SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8MT65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8MT65
Domain Number 1 Region: 356-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-26
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 468-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 3 Region: 37-98
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-24
Family KRAB domain (Kruppel-associated box) 0.00083
Further Details:      
 
Domain Number 4 Region: 412-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 318-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-16
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8MT65
Sequence length 544
Comment (sp|A8MT65|ZN891_HUMAN) Zinc finger protein 891 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF891; OC=Catarrhini; Hominidae; Homo.
Sequence
MAVMDLSSPWALTKQDSACFHLRNAEEERMIAVFLTTWLQEPMTFKDVAVEFTQEEWMML
DSAQRSLYRDVMLENYRNLTSVEYQLYRLTVISPLDQEEIRNMKKRIPQAICPDQKIQPK
TKESTVQKILWEEPSNAVKMIKLTMHNWSSTLREDWECHKIRKQHKIPGGHWRQMIYAPK
KTVPQELFRDYHELEENSKLGSKLIFSQSIFTSKHCQKCYSEIGCLKHNSIINNYVKNSI
SEKLYESHECDTTLWHFQRNQTVQKEYTYSKHGMHFTHNMFPVPNNLHMAQNACECNKDE
TLCHQSSLKKQGQTHTEKKHECNQCGKAFKRISNLTLYKKSHMGEKQYECKECGKVFNDS
STLRRHVRTHTGEKPYECNQCGKAFSQKTSLKAHMRTHTGEKPYECNQCGKSFGTSSYLI
VHKRIHTGEKLYECSECGKAFNTSSHLKVHKKIHTGENVYECSDCGKVFSGVSSLRMHIR
THTGEKPYECKECRKAFSVSSSLRRHVRIHTGEKPYECIQCGKAFSQSSSLIIHKRIHTE
RETL
Download sequence
Identical sequences A8MT65
NP_001264220.1.87134 NP_001264220.1.92137 XP_016874155.1.92137 XP_016874156.1.92137 XP_016874157.1.92137 ENSP00000437590 ENSP00000380480 ENSP00000437590 ENSP00000380480 9606.ENSP00000380480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]