SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8MYJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8MYJ7
Domain Number 1 Region: 178-380
Classification Level Classification E-value
Superfamily TPR-like 3.8e-18
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 
Domain Number 2 Region: 390-545
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000127
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 
Domain Number 3 Region: 42-245
Classification Level Classification E-value
Superfamily TPR-like 0.000000019
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8MYJ7
Sequence length 566
Comment (sp|A8MYJ7|TTC34_HUMAN) Tetratricopeptide repeat protein 34 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TTC34; OC=Catarrhini; Hominidae; Homo.
Sequence
MLQRSPRAGPSRAQGRREAAETGGPTTQEGVACGVHQLATLLMELDSEDEASRLLAADAL
YRLGRLEETHKALLVALSRRPQAAPVLARLALLQLRRGFFYDANQLVKKLVQSGDTACLQ
PTLDVFCHEDRQLLQGHCHARALAILRARPGGADGRVHTKEAIAYLSLAIFAAGSQASES
LLARARCYGFLGQKKTAMFDFNTVLRAEPGNVQALCGRALVHLALDQLQEAVDDIVSALK
LGPGTVVPELRSLKPEAQALITQGLYSHCRALLSQLPDTGAPLEDKDTQGLLAVGEALIK
IDSGQPHWHLLLADILMAQGSYEEAGTHLEKALHRAPTSEAARARLGLLQLKKGDVPGAA
RDLQSLAEVDAPDLSCLLHLLEASERQSLAQAAAQEAGTLLDAGQPRQALGYCSLSVLAS
GSSACHLRLRATCLAELQEFGRALRDLDHVLQEALGDGDLPRRAEDFCRQGRLLLSLGDE
AAAAGAFAQALKLAPSLAQNSLCRQPGRAPTARMFLLRGQCCLEEQRHAEAWTAVESGLL
VDPDHRGLKRLKARIRREASSGCWLQ
Download sequence
Identical sequences A8MYJ7
NP_001229601.1.87134 NP_001229601.1.92137 XP_016855479.1.92137 9606.ENSP00000383873 ENSP00000383873 ENSP00000383873 ENSP00000483029 ENSP00000383873 gi|336455091|ref|NP_001229601.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]