SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B4DX44 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4DX44
Domain Number 1 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.29e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.94e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 335-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 377-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.99e-17
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 154-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000324
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 7 Region: 256-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000189
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
chromosomal part 1.512 6.38
nucleoplasm part 1.369 5.81
inclusion body 2.202 4.9
chromatin 1.876 4.82
chromosomal region 1.996 4.81
cilium 1.675 4.6
ciliary part 1.819 4.6
ATPase complex 2.002 4.39
nucleolus 1.732 4
intracellular ribonucleoprotein complex 1.368 3.78

Protein sequence

External link(s) B4DX44
Sequence length 427
Comment (sp|B4DX44|ZN736_HUMAN) Zinc finger protein 736 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF736; OC=Catarrhini; Hominidae; Homo.
Sequence
MGVLTFRDVAVEFSPEEWECLDSAQQRLYRDVMLENYGNLVSLGLAIFKPDLMTCLEQRK
EPWKVKRQEAVAKHPAGSFHFTAEILPDHDIKDSFQKVILRKYGSCDLNNLHLKKDYQSV
GNCKGQKSSYNGLHQCLSATHSKTCQCNKCGRGFQLCSIFTEHKDIFSREKCHKCEECGK
DCRLFSDFTRHKKIHTVERCYKCEECGKAFKKFSNLTEHKRVHTGEKPYKCEGCGKTFTC
SSTLVKHKRNHTGDRPYKCEECGKAFKCFSDLTNHKRIHTGEKPYKCEECNKAYRWFSDL
AKHKIIHTGDKPYTCNECGKAFKWFSALSKHKRIHTGEKPYICEECGKAFTRSSTLFNHK
RIHMEERPYKCEECSKTFKCFSDLTNHKRIHTGEKPYKCEECGKASSWFSHLIRHKRIHT
REKLHKC
Download sequence
Identical sequences B4DX44
ENSP00000347210 ENSP00000400852 ENSP00000347210 ENSP00000400852 9606.ENSP00000400852 gi|283135246|ref|NP_001164376.1| ENSP00000391083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]