SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B4J4D3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4J4D3
Domain Number 1 Region: 295-476
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.18e-24
Family Prokaryotic proteases 0.0073
Further Details:      
 
Domain Number 2 Region: 174-257
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000248
Family Prokaryotic proteases 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4J4D3
Sequence length 505
Comment (tr|B4J4D3|B4J4D3_DROGR) GH20358 {ECO:0000313|EMBL:EDW01615.1} KW=Complete proteome; Reference proteome OX=7222 OS=Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi). GN=Dgri_GH20358 OC=Ephydroidea; Drosophilidae; Drosophila; Hawaiian Drosophila.
Sequence
MLLKIRHALLEVTNQSAKQSIKQSAIIINNEIIISSSNILQPHIRLAGDGDKIIQSLQQC
KLVDAQDENCAQGKLLRTLHYLVTFDRQRRRLTDRSAQQNSTSHILTRYTAQPLYVFCAA
EVSRNLHKILMNADSDEQNVLRSSFLVLTMRELKERESFKRFLQHIASYLRYLQPIHTLD
DVLVMCSPFGLENFYKTISIGKVSNVMGASLFGLSNALPLGCEGAAVFNNNLRLIGIIIC
TSFQRDQENVNLTLAANFGYLLRDFIAQLGTPISMLNLPREPSNFAWERTIVVIGSAGQQ
GTGTFIKVYNKRFILTCAHVVGQPNSQVHCRAIDQEFKSDVIWCNPDESRPYDLALLTAP
ENIPEHHCVRMSRNRATLGQTVYNAGFPYYVNFNFKYDFNPSIFQGRIIKCDQGAIMSDG
SVQAGQSGGPMFDQNGSILGVCVSNIKHEDIVYPNINTAIPTFDIRQTLQEFAKTSDIKV
LNNLVANQDVCRVWSLEMPLIQSKL
Download sequence
Identical sequences B4J4D3
XP_001986748.1.65300 7222.FBpp0154264 FBpp0154264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]