SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B4JV72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4JV72
Domain Number 1 Region: 298-576
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.28e-79
Family Eukaryotic proteases 0.0024
Further Details:      
 
Domain Number 2 Region: 158-206
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000208
Family Eukaryotic proteases 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4JV72
Sequence length 578
Comment (tr|B4JV72|B4JV72_DROGR) GH14281 {ECO:0000313|EMBL:EDV91392.1} KW=Complete proteome; Reference proteome OX=7222 OS=Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi). GN=Dgri_GH14281 OC=Ephydroidea; Drosophilidae; Drosophila; Hawaiian Drosophila.
Sequence
MVHSAGCGFQGLDPLACCPPQQQGSSRNSRWVWDTPSSSKRSTRFNNDYNRFEAYETEMH
LHEYRDFNSQLNCPQPLDEEYDDDHHLHHQQFGFPGHHYHYHVDHEVKPRPKPANRPIVF
PGDLRFHHSIETKGNGKLMADDSQEQAMPEDSTTTTAASTTSTAAPPAVRMNDPDCGISL
TTRISGGQQVVPGQYPWLARIAYRNRKLYFPNEATQVSNYGRCITPNRERALCIHLEDCK
YLYGILTTSPLRNEDKLYLSRSQCGYYNRKVLICCPDRYRDSSPVTTARPPVNSTNTNLL
PQPGQCGNLLSNRIYGGVKTKIDEYPWMALIEYTKGGGNKGHHCGGSLINNRYVVTASHC
VNGKSLPADWRLTGVRLGEWDTTTDPDCETDIRGMKDCAPPHLDVPVERTIPHPSYDPGS
KNQINDIALLRLSRQIEYTDFVRPICLPLDTNLRSAAFDGISMDVSGWGKTEELSASNLK
LKAAVDGVTLEECQSVYGRQDIFLEDTQMCAGGMEGVDSCRGDSGGPLIGQNTNKVNTYY
FLAGVVSFGPTPCGLNGWPGVYSRVGAYVDWIQTSLKP
Download sequence
Identical sequences B4JV72
7222.FBpp0148187 XP_001994763.1.65300 FBpp0148187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]