SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B7Z1M9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7Z1M9
Domain Number 1 Region: 218-335
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.9e-16
Family Synaptotagmin-like (S variant) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7Z1M9
Sequence length 353
Comment (sp|B7Z1M9|C2D4D_HUMAN) C2 calcium-dependent domain-containing protein 4D KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=C2CD4D; OC=Catarrhini; Hominidae; Homo.
Sequence
MWLLEKAGYKVGAAEPAARWAPSGLFSKRRAPGPPTSACPNVLTPDRIPQFFIPPRLPDP
GGAVPAARRHVAGRGLPATCSLPHLAGREGWAFLPESPHTRRRESLFHGPPPAPAGGLPA
AQSRLHVSAPDLRLCRAPDSDTASSPDSSPFGSPRPGLGRRRVSRPHSLSPEKASSADTS
PHSPRRAGPPTPPLFHLDFLCCQLRPTRESVLRLGPRGGQLRLSTEYQAGPGRLRLRLVS
AEGLPRPRSRPGSGGGGCCVVLRLRPRVRPREQQSRVVKCSANPIFNEDFFFDGLGPPDL
AARSLRAKVLDRGAGLRRDVLLGECETPLIALLPPLGGGLGPGSSLAPTHLSL
Download sequence
Identical sequences B7Z1M9
ENSP00000389554 9606.ENSP00000389554 NP_001129475.1.87134 NP_001129475.1.92137 XP_011507357.1.92137 XP_016855478.1.92137 ENSP00000389554 gi|209862787|ref|NP_001129475.1| ENSP00000389554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]