SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7GU08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7GU08
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily POZ domain 3.9e-36
Family BTB/POZ domain 0.00000607
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C7GU08
Sequence length 99
Comment (tr|C7GU08|C7GU08_YEAS2) Elc1p {ECO:0000313|EMBL:EEU05719.1} KW=Complete proteome OX=574961 OS=Saccharomyces cerevisiae (strain JAY291) (Baker's yeast). GN=C1Q_03931 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSQDFVTLVSKDDKEYEISRSAAMISPTLKAMIEGPFRESKGRIELKQFDSHILEKAVEY
LNYNLKYSGVSEDDDEIPEFEIPTEMSLELLLAADYLSI
Download sequence
Identical sequences A0A250WDI1 A6ZWK2 C7GU08 G2WPD2 N1NVZ0 Q03071
YPL046C YPL046C 1hv2A YPL046C YPL046C YPL046C YPL046C 4932.YPL046C YPL046C YPL046C YPL046C YPL046C tr|A6ZWK2|A6ZWK2_YEAS7 YPL046C YPL046C 1hv2_A 000006267|e1hv2A1|226.1.1.6|A:1-99 cath|current|1hv2A00/1-99 d1hv2a_ YPL046C NP_015279.1.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]