SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7PSD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7PSD4
Domain Number 1 Region: 8-226
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.74e-28
Family Prokaryotic proteases 0.0021
Further Details:      
 
Domain Number 2 Region: 388-453
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000106
Family PDZ domain 0.05
Further Details:      
 
Domain Number 3 Region: 307-389,506-561
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000345
Family Prokaryotic proteases 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7PSD4
Sequence length 567
Comment (tr|C7PSD4|C7PSD4_CHIPD) PDZ/DHR/GLGF domain protein {ECO:0000313|EMBL:ACU62698.1} KW=Complete proteome; Reference proteome OX=485918 OS=2034). GN=Cpin_5267 OC=Chitinophagaceae; Chitinophaga.
Sequence
MRKNQLLILFLLLIAGNTYCQRPAAFQPSALQTISTQLPPAYVRMWTYDTTTHQQMSATF
SGVVVTKEGHILTVAHTTVPGNTYMVTFTDGRAAIAMALGKINFPETPELPDVAMMKILT
PGDWPVAPMGWSYDLKENEPCFSIAYPESLNQPLPMMTAGHITRVKNEKGFIESTCMMEP
GDSGGPLFDYLGRVIGLRSAIEPDEKKNYDVPVDLYRKYWAALLQPVHYLKYPEIRDSIN
TDPSEGLISSHDQLESLRLTMKTNKLNKMASVQVESVAGNQQRSINGLLIDVKGQSFVVS
KNSEVAQEPLVLYNGKSIKTRIIARDKENDLVLLGLDAHVKGGIAFPVNGPVAIGRGVFL
LSPQPDTLAIASVFGKDTFSLPKMSSLGFLGAAIAPDKQPLVLTYVMPGSPADAKGATPG
DEIISINGVAVNEPMDYGRELSAYWPGDTVIIKRRLHAVAEGTDGVAGKVHQVAEVNDTI
VLAKRPQLPATHATDLFRGGKSERRDGFQSVIAHDAILRPEQCGGPVFTTAGVLAGINIA
RHSRTVTLAVPAALVQAFVLQNIGVKH
Download sequence
Identical sequences C7PSD4
gi|256424246|ref|YP_003124899.1| WP_012792866.1.2976 485918.Cpin_5267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]