SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for D0K8R8 from Uniprot 2013_05

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D0K8R8
Domain Number - Region: 94-202
Classification Level Classification E-value
Superfamily PH0156-like 0.00654
Family PH0156-like 0.0093
Further Details:      
 

Protein sequence

External link(s) D0K8R8
Sequence length 208
Comment (tr|D0K8R8|D0K8R8_STAAD) Uncharacterized protein KW=Complete proteome OX=681288 OS=Staphylococcus aureus (strain ED98). GN=SAAV_0345 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcus.
Sequence
MKKRLLLSTFLASALILTGCASDQSDNEDHHTSTGIHAPKSAKKLETKDIFNSDKKNSDI
SDAEMKQAIEKYLSVNSDILDNKYIMQHKLDKQIDSQTKVTEKQAETLSHLSNLAVKNDL
HFKKFVTENNIPKEYKKPVELMMNYFKALNSTIANVDEDIEKLSYQPQNKINVVDVPTKY
AGDVNKKQQDKIKDFLKSKGIKSDVIDK
Download sequence
Identical sequences A5IPV8 A6TYN0 A7WY75 C5N1R6 C5Q569 C8L7Q3 C8LGR9 C8LNN5 C8M223 C8M712 C8MN16 C8MW57 C8N1N3 D0K8R8 D1QH68 D1QZ26 D3ESZ3 D4UCX5 D6T7A9 E5R7D3 E5TUS3 F3TCL3 F5WFF2 F5WPV7 F9K571 F9KIL6 F9KUU6 H1T9Y2 H3X5K2 H3Y7H3 H3YZT0 H4AA51 H4AHT8 H4ARG1 H4AYU3 H4BM37 H4D7U5 H4DP39 H4EP81 H4HDA7 I0JAC8 I0U1C4 I3FDW1 I3FH67 I3FWN8 I3G1V5 I3G714 I3GQS8 I3GTK4 I3GUJ8 I3HEP4 I3HHG8 I3HK59 J6ANZ1 K0L2A6 L8QJS4 Q7A7J2 Q99WJ9
gi|386830048|ref|YP_006236702.1| gi|148266864|ref|YP_001245807.1| gi|470196495|ref|YP_007582896.1| gi|156978706|ref|YP_001440965.1| gi|387149562|ref|YP_005741126.1| jgi|Aspzo1|145361|fgenesh1_pg.16_#_45 gi|15926079|ref|NP_373612.1| gi|470222053|ref|YP_007620610.1| gi|15923368|ref|NP_370902.1| gi|470218230|ref|YP_007618624.1| gi|470192564|ref|YP_007578917.1| 158878.SAV0378 158879.SA0363 359786.SaurJH9_0426 359787.SaurJH1_0437 418127.SAHV_0375 681288.SAAV_0345 gi|150392910|ref|YP_001315585.1| gi|470190599|ref|YP_007576909.1| gi|269202025|ref|YP_003281294.1| gi|470194529|ref|YP_007580881.1| gi|470198460|ref|YP_007584860.1| gi|470224018|ref|YP_007622597.1| gi|537460121|ref|YP_008490561.1| gi|384863732|ref|YP_005749091.1|

Jump to [ Top of page · Domain architecture · Domain assignment details ]