SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for D5TGR2 from Uniprot 2014_06

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5TGR2
Domain Number 1 Region: 4-311
Classification Level Classification E-value
Superfamily Aspartate/ornithine carbamoyltransferase 1.57e-94
Family Aspartate/ornithine carbamoyltransferase 0.00000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
mitochondrial envelope 1.573 11.16
organelle inner membrane 1.669 8.48

Protein sequence

External link(s) D5TGR2
Sequence length 320
Comment (tr|D5TGR2|D5TGR2_BIFAV) Ornithine carbamoyltransferase, catabolic KW=Complete proteome OX=573236 OS=Bifidobacterium animalis subsp. lactis (strain V9). GN=arcB OC=Bifidobacteriaceae; Bifidobacterium.
Sequence
MGELRHMLRDDDVNHEEQKQILELGMKFRADRFYHRPFEGPQGVAVIFDKPSTRTRSSFS
IGVAELGGYPLVIDKSGSQLGRGEPVADTAEVLTRMAYGIVWRTFEQSRVEQMARVATVP
VVNALTDEFHPCQVLADFLTLAQFKGGVDNLENLKIAYVGDAANNMSNSYLLAGAVAGMD
VRVAGPNGYLPDQKIVEDAQAIAETTGGSIMVTVDPEQAVDGVDCIFTDTWVSMGEEAEY
AIRSKPFWPYQVNERLMGLAKPDALFQHCLPAYRGKEVTTGVIDGPQSVVWDEAENRLHA
QKALLTWLIGKQRGDESLLS
Download sequence
Identical sequences B2E997 B8DU58 C6A7J8 C6AI56 D3R4S2 D5TGR2 G0H582 G2SVI0 H0KKC3 I6PMA0 I6PYF4 S0A8W3 U3Q2I8
gi|241190764|ref|YP_002968158.1| gi|384191008|ref|YP_005576756.1| 442563.BLA_1249 555970.Balat_0723 580050.Balac_0723 gi|387820632|ref|YP_006300675.1| gi|518657146|ref|YP_008143508.1| gi|384192155|ref|YP_005577902.1| gi|384193758|ref|YP_005579504.1| gi|384195322|ref|YP_005581067.1| gi|241196170|ref|YP_002969725.1| gi|549472213|ref|YP_008605920.1| gi|219683730|ref|YP_002470113.1| gi|387822307|ref|YP_006302256.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]