SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for D5TGR2 from Uniprot 2013_05

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5TGR2
Domain Number 1 Region: 4-311
Classification Level Classification E-value
Superfamily Aspartate/ornithine carbamoyltransferase 1.57e-94
Family Aspartate/ornithine carbamoyltransferase 4.61e-06
Further Details:      
 

Protein sequence

External link(s) D5TGR2
Sequence length 320
Comment (tr|D5TGR2|D5TGR2_BIFAV) Ornithine carbamoyltransferase KW=Complete proteome OX=573236 OS=Bifidobacterium animalis subsp. lactis (strain V9). GN=arcB OC=Bifidobacteriaceae; Bifidobacterium.
Sequence
MGELRHMLRDDDVNHEEQKQILELGMKFRADRFYHRPFEGPQGVAVIFDKPSTRTRSSFS
IGVAELGGYPLVIDKSGSQLGRGEPVADTAEVLTRMAYGIVWRTFEQSRVEQMARVATVP
VVNALTDEFHPCQVLADFLTLAQFKGGVDNLENLKIAYVGDAANNMSNSYLLAGAVAGMD
VRVAGPNGYLPDQKIVEDAQAIAETTGGSIMVTVDPEQAVDGVDCIFTDTWVSMGEEAEY
AIRSKPFWPYQVNERLMGLAKPDALFQHCLPAYRGKEVTTGVIDGPQSVVWDEAENRLHA
QKALLTWLIGKQRGDESLLS
Download sequence
Identical sequences B2E997 B8DU58 C6A7J8 C6AI56 D3R4S2 D5TGR2 G0H582 G2SVI0 H0KKC3 I6PMA0 I6PYF4
442563.BLA_1249 555970.Balat_0723 580050.Balac_0723 gi|384193758|ref|YP_005579504.1| gi|241190764|ref|YP_002968158.1| gi|387822307|ref|YP_006302256.1| gi|384195322|ref|YP_005581067.1| gi|219683730|ref|YP_002470113.1| gi|384191008|ref|YP_005576756.1| gi|549472213|ref|YP_008605920.1| gi|241196170|ref|YP_002969725.1| gi|518657146|ref|YP_008143508.1| gi|384192155|ref|YP_005577902.1| gi|387820632|ref|YP_006300675.1|

Jump to [ Top of page · Domain architecture · Domain assignment details ]