SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5UVE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5UVE3
Domain Number 1 Region: 3-272
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.45e-41
Family Eukaryotic proteases 0.00056
Further Details:      
 
Domain Number 2 Region: 293-466
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000000000154
Family Prokaryotic proteases 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5UVE3
Sequence length 519
Comment (tr|D5UVE3|D5UVE3_TSUPD) Peptidase S1 and S6 chymotrypsin/Hap {ECO:0000313|EMBL:ADG77733.1} KW=Complete proteome; Reference proteome OX=521096 OS=NBRC 16120 / NCTC 13040) (Corynebacterium paurometabolum). GN=Tpau_1101 OC=Tsukamurella.
Sequence
MRRLVIILIGTALLALAGGPPAGAIIGGKVAPEAPPSLGSLQVELPGDAVTPDNHRCGTT
LIAPQWVVTASHCAILGNAGDAATGPMRASVRIGSTNTGTGGELVGVDRFYRLGTPTEAR
EDGYDWLLRDIALLRLERPVRATPIPIASKTPAAGTPARIMGWGSTCSDPAKMRDPQCYP
SELRTAETAVQDARACPNIQGSDTPRPLCIGGKDGRPTIGNADSGSPALVQENGAWVIAG
VVSGPGTNDDKGPGLYMDLTQQRDWIDSIINNTIVPDAPPTPDVAGAVLLGNCIGSIVRP
PGATPDAPAMVLTNGHCVSGDRPAPGGATVNQPSNRTMLAAGRTGESVTTVRADRLVYAT
MSRTDVAVYRLDSTYAQVAARGATVFDLATTPIRPGDRFSMNTGAARKSCSAEAVVPTVR
EGDWEQRDSVRYRDCSSVPGESGSPLISPDGRTVVGVNNSSNTDGEKCTDDNPCEIAADG
TVTAVKGRSYGQQIDALARCLTRDSIDLSRPGCDLPGAA
Download sequence
Identical sequences D5UVE3
gi|296138829|ref|YP_003646072.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]