SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D6RF30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D6RF30
Sequence length 607
Comment (sp|D6RF30|GOG8K_HUMAN) Golgin subfamily A member 8K KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GOLGA8K OC=Catarrhini; Hominidae; Homo.
Sequence
MAEETQHNKLAAAKKKLKEYWQKNSPRVPAGANRNRKTNGSIPEKATSGGCQPPRDSATG
FHREGPTSSATLKDLESPCQERAVVLDSRSVEISQLKNTIKSLKQQKKQVEHQLEEEKKA
NNKKQKAKRVLEVQIQTLNIQKEELNTDLYHMKRSLRYFEEKSKDLAVRLQHSLQRKGEL
ESVLSNVMATQKKKANQLSSRSKARTEWKLEQSMREEALLKVQLTQLKESFQQVQLERDE
YSEHLKGERARWQQRMRKMSQEICTLKKEKQQDMRRVEKLERSLSKLKNQMAEPLPPEPP
AVPSEVELQHLRKELERVAGELQAQVKKNQRISLLNQRQEERIQEQEERLRKQEERIQEQ
HKSLQQLAKPQSVFEEPEHLEAASQQNQQLTAQLSLMALPGEGHGEHLDSEGEEAPQPMP
SVPEDLESREAMSSFMDHLKEKADLSELVKKELCFIHHWRDRRHQKTHHLLSEPGGCAKD
AALGGGHHQAGAQGGDEGEAAGAAADGIAAYSNYNNGHRKFLAAAHNPADEPGPGAPAPQ
ELGAADKHGDLREVSLTSSAQGEAREDPLLDKPTAQPIVQDHKEHPGLGSNCCVPLFCWA
WLPRRRR
Download sequence
Identical sequences D6RF30
ENSP00000426691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]