SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D6RGH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6RGH6
Domain Number 1 Region: 176-242
Classification Level Classification E-value
Superfamily Geminin coiled-coil domain 2.75e-25
Family Geminin coiled-coil domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D6RGH6
Sequence length 385
Comment (sp|D6RGH6|MCIN_HUMAN) Protein Idas KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MCIDAS; OC=Catarrhini; Hominidae; Homo.
Sequence
MQACGGGAAGRRAFDSICPNRMLALPGRALLCKPGKPERKFAPPRKFFPGCTGGSPVSVY
EDPPDAEPTALPALTTIDLQDLADCSSLLGSDAPPGGDLAASQNHSHQTEADFNLQDFRD
TVDDLISDSSSMMSPTLASGDFPFSPCDISPFGPCLSPPLDPRALQSPPLRPPDVPPPEQ
YWKEVADQNQRALGDALVENNQLHVTLTQKQEEIASLKERNVQLKELASRTRHLASVLDK
LMITQSRDCGAAAEPFLLKAKAKRSLEELVSAAGQDCAEVDAILREISERCDEALQSRDP
KRPRLLPEPANTDTRPGNLHGAFRGLRTDCSRSALNLSHSELEEGGSFSTRIRSHSTIRT
LAFPQGNAFTIRTANGGYKFRWVPS
Download sequence
Identical sequences D6RGH6
NP_001177716.1.87134 NP_001177716.1.92137 gi|299782571|ref|NP_001177716.1| ENSP00000426359 ENSP00000426359 ENSP00000426359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]