SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7B820 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7B820
Domain Number 1 Region: 18-260
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.16e-37
Family Eukaryotic proteases 0.0056
Further Details:      
 
Domain Number 2 Region: 282-457
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000000000635
Family Prokaryotic proteases 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7B820
Sequence length 514
Comment (tr|D7B820|D7B820_NOCDD) Peptidase S1 and S6 chymotrypsin/Hap {ECO:0000313|EMBL:ADH70328.1} KW=Complete proteome; Reference proteome OX=446468 OS=509) (Actinomadura dassonvillei). GN=Ndas_4945 OC=Nocardiopsis.
Sequence
MRSRTLLPALVLAVTATVVTAVPAHAIVGGNPSTQSYEFMGSFQPDYPAPPRPDGHGCGV
VVLAPQWVLTASHCAGKNPTNARTGVPRGWSVRVGSPDSDSGGEVAEVDHYYRLATSGDE
GGFWGRDLALMHLERPVEAQPLPIASASPPPGTPVRIMGWGMTCDDAGNPDCFPTRLREA
DTVVQPPSACLGQAVEGELCVGSRDGSVAAANMDSGGPALVREDGAWALAGVVSGPSGEG
APTLFTDATRHTGWIDGVVSGTDVPPDDEIPDVEGMVDLQGCVGSVVRTPASEPDAPALM
LTNGHCVREDWPAPGEALVDRPADLEVPVADPRGYPRVTARAERLVYATMTGTDVALYRL
DRTYEQLASQGAKTFELGTTPVRPGDEVTMVSPGTRSDCSVEAVPAHLREGGYQQDDPIR
YASGEGCLPYPGMSGSVLLAPDGSTVVGVHNTHNRDGEECTDDNPCEVDADGNVTFERGR
GYGQQVHTVPACLTDRSELDLSRRGCSLTGAGSA
Download sequence
Identical sequences D7B820
gi|297563861|ref|YP_003682834.1| WP_013155935.1.70090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]