SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3BSY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3BSY2
Sequence length 632
Comment (sp|H3BSY2|GOG8M_HUMAN) Golgin subfamily A member 8M KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GOLGA8M OC=Catarrhini; Hominidae; Homo.
Sequence
MAEETQHNKLAAAKKKLKEYWQKNSPRVPAGANRNRKTNGSIPQTATSGGCQPPGDSATG
FHREGPTSSATLKDLESPCQERAVVLDSRSVEISQLKNTIKSLKQQKKQVEHQLEEEKKA
NNKKQKAKRVLEVQLQTLNIQKEELNTDLYHMKRSLRYFEEKSKDLAVRLQHSLQRKGEL
ESVLSDVMATQKKKANQLSSPSKAGTEWKLEQSMREEALLKVQLTQLKESFQQVQLERDE
YSEHLKGERARWQQRMRKMSQEICTLKKEKQQDMRRVEKLERSLSKLKNQMAEPLPPEPP
AVPSEVELQHLRKELERVAGELQAQVKNNQRISLLNQRQEERIREQEERLRKQEERIQEQ
HKSLQQLAKPQSVFEEPNNENKSTLQLEQQVKELQEKLGEEHLEAASQQNQQLTAQLSLM
ALPGEGHGGEHLDSEGEEAPQPMPSVPEDPESREAMSSFMDHLEEKADLSELVKKQELRF
IQYWQERCHQKIHHLLSEPGGRAKDAALGGGHHQAGAQGGDEGEAAGAAADGIAAYSNYN
NGHRKFLAAAHNSADEPGPGAPAPQELGAADKHGDLCEVSLTSSAQGEAREDPLLDKPTA
QPIVQDHQEHPGLGSNCCVPFFCWAWLPRRRR
Download sequence
Identical sequences H3BSY2
ENSP00000456927 NP_001269397.1.87134 NP_001269397.1.92137 ENSP00000456927 ENSP00000456927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]