SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for H4BM37 from Uniprot 2014_06

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H4BM37
Domain Number - Region: 94-202
Classification Level Classification E-value
Superfamily PH0156-like 0.00654
Family PH0156-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H4BM37
Sequence length 208
Comment (tr|H4BM37|H4BM37_STAAU) Lipoprotein OX=931432 OS=Staphylococcus aureus subsp. aureus CIG1057. GN=SACIG1057_0920 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcus.
Sequence
MKKRLLLSTFLASALILTGCASDQSDNEDHHTSTGIHAPKSAKKLETKDIFNSDKKNSDI
SDAEMKQAIEKYLSVNSDILDNKYIMQHKLDKQIDSQTKVTEKQAETLSHLSNLAVKNDL
HFKKFVTENNIPKEYKKPVELMMNYFKALNSTIANVDEDIEKLSYQPQNKINVVDVPTKY
AGDVNKKQQDKIKDFLKSKGIKSDVIDK
Download sequence
Identical sequences A0A008BXY9 A0A008CA51 A0A008CL46 A0A008CQB8 A0A008D5S8 A0A008DDK0 A0A008DRB8 A0A008ECH3 A0A008ESY9 A0A008FVQ7 A0A008G658 A0A008GQ32 A0A008HKQ9 A0A008HQT6 A0A008HT11 A0A008IZQ2 A0A008JCH7 A0A008JHQ2 A0A008JY67 A0A008K3U5 A0A008KCS8 A0A008LBB4 A0A008LCS1 A0A008LGT2 A0A008LMS3 A0A008MHJ5 A0A008MYA0 A0A008N7J6 A0A008NCP1 A0A008NZS7 A0A008PCP6 A0A008Q7X4 A0A008QJ70 A0A008QU75 A0A008RVK6 A0A008S3D9 A0A008SJF5 A0A008SQE2 A0A008SRP7 A0A008TPN7 A0A008U2H7 A0A008UD80 A0A008UH13 A0A008UK58 A0A008URE4 A0A008VSZ2 A0A008W0Z1 A0A008XA38 A0A008XFL5 A0A008YSG8 A0A008ZUG5 A0A009A4I0 A0A009ATE1 A0A009AY10 A0A009BSN4 A0A009C6V2 A0A009CAP2 A0A009DA31 A0A009DB59 A0A009E4G7 A0A011VJS5 A0A011W9S2 A0A011WCL0 A0A011WI56 A0A011WPB9 A0A011WW12 A0A011WW30 A0A011XR01 A0A011XV01 A0A011XVK1 A0A011XYB3 A0A011Y729 A0A011YL30 A0A011YU04 A0A011Z193 A0A011Z6H1 A0A011Z8L2 A0A011Z9T1 A0A011ZCI5 A0A011ZJA9 A0A011ZKH0 A0A011ZT43 A0A012AH14 A0A012ATQ2 A0A012AXK0 A0A012AYJ6 A0A012AYR9 A0A012BC76 A0A012BEH8 A0A012BTJ9 A0A012C9D8 A0A012CMX3 A0A012CSS3 A0A012DD09 A0A012DY04 A0A012E041 A0A012E482 A0A012EB29 A0A012ECE2 A0A012EGT1 A0A012EIN4 A0A012EJM8 A0A012EXR0 A0A012F5Y2 A0A012FAU8 A0A012FCP5 A0A012FM62 A0A012G0U9 A0A012GDA5 A0A012GY30 A0A012H9N7 A0A012HDM8 A0A012HFX8 A0A012HKR9 A0A012HNY2 A0A012HPW1 A0A012HYC5 A0A012IDD5 A0A012ILA7 A0A012INB8 A0A012IYP3 A0A012JIT4 A0A012JPV1 A0A012JUI0 A0A012JZN2 A0A012K6T3 A0A012KCX9 A0A012KQA4 A0A012KWJ3 A0A012KXB6 A0A012LJ60 A0A012LSW5 A0A012MC33 A0A012MG68 A0A012MTK1 A0A012N021 A0A012N3A4 A0A012NDE7 A0A012NKW1 A0A012NS45 A0A012NZA0 A0A012NZM1 A0A012PJL2 A0A012PX43 A0A012Q0Z9 A0A012UH72 A0A012V9Z2 A0A012VAY4 A0A012WC49 A0A012WLS3 A0A012WPR1 A0A012X360 A0A012X9H8 A0A012XTU1 A0A013A7A5 A0A013AVZ6 A0A013BAY5 A0A013BE67 A0A013DTS8 A0A013DWT7 A0A013EAN7 A0A013EHG9 A0A013F2M8 A0A013G5C1 A0A013G8A7 A0A015LTK1 A0A015MM39 A0A015NM40 A0A017U1N3 A0A017UBH9 A0A017UUA3 A0A017UXQ2 A0A017VGI2 A0A017WL77 A0A017X2R6 A0A017XAN9 A0A017XE43 A0A017XNC9 A0A017XSM1 A0A017Y2G0 A0A017Y5S0 A0A017YGJ6 A0A017ZFI5 A0A017ZQL2 A0A018AF20 A0A018APT7 A0A018BDW7 A0A018BJJ7 A0A018BYB5 A0A018CHF6 A0A018CXY1 A0A018DTM8 A0A018E5R8 A0A018FC11 A0A018GEY3 A0A018HNU0 A0A018JBE4 A0A018JLR5 A0A018JUV2 A0A018KSW4 A0A018LHC3 A0A018LP91 A0A018LRZ3 A0A018LZ46 A0A018MET7 A0A018MRG3 A0A018N145 A0A019ALD7 A0A019BAB4 A0A019BKR6 A0A019BQV3 A0A019BWJ4 A0A019C3C5 A0A019CX62 A0A019DQ52 A0A019DQT1 A0A019E572 A0A019EAT1 A0A019EJ77 A0A019EWZ1 A0A019F5Q5 A0A019FBY4 A0A019G9Y9 A0A019GBF2 A0A019GFB3 A0A019H758 A0A019HGP4 A0A019HH22 A0A019I4P2 A0A019I4T8 A0A019IR65 A0A019ISY5 A0A019JT76 A0A019JTY8 A0A019K4G1 A0A019KG84 A0A019KPP3 A0A019L2V3 A0A019L344 A0A019LF40 A0A019LH01 A0A019LU98 A0A019ML89 A0A019MNN5 A0A019MS88 A0A019P4M3 A0A019QUM5 A0A019R704 A0A019RF39 A0A019RJ40 A0A019RQX1 A0A019SG04 A0A019T479 A0A019TU81 A0A019U5F4 A0A019UDP8 A0A019VNC1 A0A019W1U7 A0A019WJ68 A0A019XAV8 A0A019XKW9 A0A019XSQ2 A0A019Y2Y1 A0A019YHL7 A0A019YRN4 A0A019YRV9 A0A019ZVY8 A0A019ZZ85 A0A020AII0 A0A020AS92 A0A020AVH2 A0A020BX05 A0A020CNT4 A0A020CWJ5 A0A020DHK1 A0A020DPC3 A0A020DU20 A0A020E5M7 A0A020ESA3 A0A020EUK1 A0A020EZ51 A0A020EZR7 A0A020FGC6 A0A020FHD0 A0A020FK55 A0A020FT30 A0A020GD11 A0A020GH17 A0A020GI71 A0A020GYF3 A0A020H231 A0A020H8T0 A0A020HEF2 A0A020HX33 A0A020I2F7 A0A020I3G4 A0A020I7X7 A0A020IFH8 A0A020IML8 A0A020J137 A0A020J7A8 A0A020JJP6 A0A020JMG7 A0A020JNN1 A0A020JS28 A0A020KDQ9 A0A020KSY7 A0A020KVR6 A0A020KX89 A0A020L6N4 A0A020LC97 A0A020LDC4 A0A020LQN0 A0A020LS37 A0A020LZ14 A0A020MD27 A0A020MPZ6 A0A020MT25 A0A020N362 A0A020NBR9 A0A020NL96 A0A020NQ93 A0A020NUU7 A0A020P4I9 A0A020PAA2 A0A020PMT1 A0A020PUW7 A0A020Q8J1 A0A020QFX5 A0A020QFZ5 A0A020QNM6 A0A020QTT7 A0A020R822 A0A020R871 A0A020RAM1 A0A020RRK8 A0A020S4S3 A0A020SCD9 A0A020SFG5 A0A020SJG9 A0A020SUU8 A0A020T6X3 A0A020TBF1 A0A020THQ8 A0A020U0J4 A0A020U461 A0A020UHC2 A0A020UHE5 A0A020UKN8 A0A020V1J9 A0A020V2V3 A0A020VDC4 A0A020VIA7 A0A020VTE7 A0A020VWV5 A0A020W984 A0A020WEV8 A0A020WPU5 A0A020WRM2 A0A020XCY3 A0A020XGX1 A0A020XIJ0 A0A020XU40 A0A020Y3P7 A0A020YJV3 A0A020YKM8 A0A020YP54 A0A020YP85 A0A020Z493 A0A020Z6E8 A0A020ZQU0 A0A021A4W1 A0A021A8K8 A0A021ABJ5 A0A021ANR3 A0A021AQX7 A0A021B5T7 A0A021B5Z3 A0A021BJC4 A0A021BML8 A0A021BN08 A0A021C9B6 A0A021C9P6 A0A021CE81 A0A021D198 A0A021DES4 A0A021DFP8 A0A021DKA4 A0A021E0P1 A0A021E2S4 A0A021EG01 A0A021EVY4 A0A021F0H7 A0A021FAV9 A0A021FBG5 A0A021FDG7 A0A021FXJ0 A0A021GBG1 A0A021GE81 A0A021GFI5 A0A021GZE7 A0A021H4K6 A0A021H931 A0A021HIX5 A0A021HQV9 A0A021I0M4 A0A021IBJ1 A0A021IHM9 A0A021IK21 A0A021ILW2 A0A021IUY1 A0A021JE13 A0A021JEI3 A0A021JKE9 A0A021K6Q2 A0A021KE98 A0A021KEF6 A0A021KPH5 A0A021KU62 A0A021L8Y3 A0A021LFF8 A0A021LV60 A0A021LZ18 A0A021M0H5 A0A021MJ08 A0A021MLX1 A0A021N8B2 A0A021NDM2 A0A021NNY2 A0A021NUI3 A0A021P373 A0A021P9Q4 A0A021PDB8 A0A021PVM8 A0A021Q1R7 A0A021Q9E2 A0A021QEJ1 A0A021QFV6 A0A021QYU3 A0A021R0M1 A0A021R5G1 A0A021RRQ9 A0A021S2K6 A0A021S6X7 A0A021SD59 A0A021SDM0 A0A021SQP0 A0A021SR56 A0A021T314 A0A021TGD1 A0A021TS86 A0A021TUE5 A0A021TZ28 A0A021UE97 A0A021UHU8 A0A021USX5 A0A021V3U5 A0A021VFT6 A0A021VG88 A5IPV8 A6TYN0 A7WY75 C5N1R6 C5Q569 C8L7Q3 C8LGR9 C8LNN5 C8M223 C8M712 C8MN16 C8MW57 C8N1N3 D0K8R8 D1QH68 D1QZ26 D3ESZ3 D4UCX5 D6T7A9 E5R7D3 E5TUS3 F3TCL3 F5WFF2 F5WPV7 F9K571 F9KIL6 F9KUU6 H1T9Y2 H3X5K2 H3Y7H3 H3YZT0 H4AA51 H4AHT8 H4ARG1 H4AYU3 H4BM37 H4D7U5 H4DP39 H4EP81 H4HDA7 I0JAC8 I0U1C4 I3FDW1 I3FH67 I3FWN8 I3G1V5 I3G714 I3GQS8 I3GTK4 I3GUJ8 I3HEP4 I3HHG8 I3HK59 J6ANZ1 K0L2A6 L8QJS4 M7XUX7 N1XJ47 N1XVL9 N1Y977 N1YCS5 N1YGF2 N1YU56 N1Z5L3 N1ZKR9 N4Y7T0 N4YAM1 N4YFM1 N4ZBP3 N5BEK4 N5BKE2 N5BMX0 N5BMZ1 N5C044 N5CCU6 N5CNH4 N5CUB4 N5D6U1 N5DK20 N5DPI0 N5DTC4 N5E1P5 N5E7L5 N5EBH2 N5EQZ3 N5EXE5 N5F448 N5F6K3 N5FB45 N5FTR6 N5FVV3 N5G5W4 N5GAI2 N5GW50 N5H4H7 N5HAB2 N5HRZ8 N5HVK8 N5IC75 N5IF75 N5II91 N5ITL3 N5IVL7 N5J1W4 N5JBC3 N5JFK3 N5K142 N5K831 N5KEA1 N5LD46 N5LGC3 N5LHW0 N5LS15 N5LVT2 N5LYH0 N5M7K0 N5M9N1 N5MQV9 N5NAJ9 N5NLF3 N5P2N6 N5P5N2 N5PKD3 N5PWH2 N5Q227 N5Q4M3 N5QPS2 N5QX96 N5QYB2 N5R8G4 N5RAP1 N5S1M2 N5SDJ8 N5SLD4 N5SSG3 N5T2M5 N5T4J2 N5TBM1 N5TNW7 N5TR09 N5TUR6 N5U332 N5U4G1 N5USB3 N5UUT7 N5V9L5 N5VGH4 N5VJZ6 N5W0W9 N5WRM1 N5X451 N5XAG2 N5XCJ0 N5XD35 N5XN77 N5XXI0 N5YAK5 N5YC00 N5YGW9 N5YND9 N5YUC8 N5Z8P6 N5ZER2 N6A285 N6A6A9 N6B0B3 N6B190 N6B5S2 N6BC67 N6BDL4 N6BI24 N6BP80 N6BY84 N6C5I5 N6CGH0 N6CJY0 N6CVJ0 N6CYW1 N6E0L7 N6E741 N6E8K1 N6EC74 N6ES26 N6ETL7 N6EVR2 N6FF59 N6FNC5 N6GBX2 N6GJ73 N6GSL1 N6GVP9 N6GY71 N6H3W9 N6HA72 N6HCW3 N6HGQ6 N6HKE7 N6HQR4 N6IGA0 N6J082 N6JBL1 N6JGF6 N6JU07 N6JWP0 N6K945 N6KIK3 N6KPH9 N6L1R6 N6L8W4 N6L953 N6LDI1 N6LE23 N6M655 N6MF69 N6MUU7 N6MW97 N6N4D7 N6NHL6 N6NNY7 N6P966 N6PFJ1 N6PFT1 N6PY04 N6Q1P1 N6Q6K4 N6QCX3 N6QFJ3 N6R061 N6R3F5 N6R3V3 N6RPX3 N6RRE7 N6S0Q5 N6S5M6 N6TEV2 N6TNK2 N6TUA8 Q7A7J2 Q99WJ9 R9D1D3 R9GHM4 S9SUU7 T1Y744 T2R415 W7NNX3 W8UTE8 X8NG30 X8NSZ1 X8NXG5 X8P9A6 X8PGF9 X8PJP3 X8PTX3 X8Q0P7 X8QD67 X8QJT7 X8QLF7 X8QS95 X8R3V5 X8REW9 X8RM13 X8RYH2 X8S0T7 X8S8U0 X8SFW9 X8SU99 X8T4S8 X8TEI2 X8TR67 X8U3A7 X8UAL4 X8UIB3 X8UWM1 X8V3T9 X8VDH7 X8VH73 X8VRE5 X8W044 X8WED5 X8WKV8 X8WVB2 X8X9V9 X8XIS2 X8XX75 X8Y6A9 X8YD32 X8YNS1 X8YYF6 X8Z269 X8ZB14 X8ZBZ9 X8ZVH3 X9A4Y7 X9A7S5 X9ARN0 X9B5D6 X9BBV8 X9BQW2 X9BW18 X9BYC4 X9C526 X9CGU1 X9CIQ8 X9CUP3 X9D0S2 X9DK53 X9DUG6 X9E7J9 X9EA36 X9EKV6 X9ESL9 X9F138 X9FB84 X9FDF9 X9FW36 X9GDN2 X9GNB1 X9GUL2 X9H953 X9HAF5 X9HK10 X9HKK2 X9HP63 X9I3P2 X9I7J2 X9I7L2 X9IVP8 X9IYJ9 X9J4F6 X9JD99 X9JK61 X9K7N8 X9KH28 X9KQ12 X9KXV7 X9L8Q6 X9LK27 X9M2B8 X9M823 X9MHE6 X9MIA1 X9MRI6 X9MVJ4 X9NBS0 X9NPE7 X9NSW0 X9NXN9 X9P8F1 X9PEL3 X9PWL5 X9Q0W5 X9QBJ3 X9QNP5 X9QTL7 X9RAC1 X9RAG5 X9RFM9 X9RVU8 X9S2V5 X9SE86 X9SLQ3 X9SR90 X9SWI9 X9SZJ4 X9TMJ6 X9TWL6 X9U0U1 X9UMR6 X9UZL4 X9VRU4 X9W292 X9W9G6 X9WDI6 X9WPC3 X9X3G4 X9XFB7 X9XGP0 X9XNK1 X9XXB2 X9XZN5 X9YP16 X9YQP0 X9YSP8 X9ZAW9 X9ZG01 X9ZGV9 X9ZX17 X9ZY73 Y0A9Y7 Y0AJY0 Y0ARJ9 Y0B427 Y0BAC8 Y0BEN0 Y0BNP8 Y0C4N2 Y0CAV0 Y0CBE7 Y0CQQ4 Y0D731 Y0DCU1 Y0DMJ2 Y0DN47 Y0DRH2 Y0EBH0 Y0EG78 Y0EVN9 Y0EVT2 Y0F7T2 Y0FBS9 Y0FIF4 Y0FTE4 Y0G3V1 Y0G6W9 Y0GNB0 Y0GQS9 Y0H4Z6 Y0HGR1 Y0HXP2 Y0HYM0 Y0I5B1 Y0IPG4 Y0J1J3 Y0JBN0 Y0JE83 Y0JFR5 Y0JUK3 Y0JXW6 Y0K7Q7 Y0KZ97 Y0L9K6 Y0LP61 Y0LSF8 Y0M4A5 Y0MBX3 Y0MIY6 Y0MR78 Y0MT19 Y0N7A6 Y0NDL3 Y0NFY9 Y0NI84 Y0P235 Y0P5V4 Y0P820 Y0PT61 Y0PTY1 Y0Q5L8 Y0QI32 Y0QK32 Y0QST9 Y0QX96 Y0RJK5 Y0RJK6 Y0RPE9 Y0RYU0 Y0S5A5 Y0SH77 Y0STD3 Y0T2Q7 Y0TA71 Y0TAY1 Y0TM92 Y0U0P8 Y0U796 Y0UDY8 Y0UIG8 Y0UJ95 Y0UZ87 Y0V373 Y0VE28 Y0VN34 Y0VTS6 Y0W6H1 Y0WBQ1 Y0WKP0 Y0WLL6 Y0WXT4 Y0X6R9 Y0XEP3 Y0XF93 Y0XXQ0 Y0Y0B4 Y0Y5K9 Y0YI73 Y0YN87 Y0YWA6 Y0Z552 Y0Z8G1 Y0ZFX4 Y0ZQ32 Y0ZSP0 Y1A3A9 Y1R7F6 Y1RAH9 Y1RK92 Y1RL38 Y1RUY9 Y1S5J2 Y1SJ17 Y1SSZ0 Y1T1Q3 Y1TAM0 Y1TDH1 Y1TEP2 Y1TTR9 Y1TWP5 Y1U3K4 Y1UCY2 Y1UHA0 Y1UQT3 Y1UTQ0 Y1V3R7 Y1VJC2 Y1VW82 Y1VYX7 Y1W9T9 Y1WBM3 Y1WJ75 Y1WQK7 Y1WVJ4 Y1XCS4 Y1XI70 Y1XID9 Y1XW80 Y1Y4J3 Y1YER5 Y1YLZ0 Y1YQP3 Y1Z8I4 Y1ZBQ7 Y1ZNH8 Y1ZTA1 Y1ZZW5 Y2A3B4 Y2AGR0 Y2AMG7 Y2ARX8 Y2BCZ0 Y2BD62 Y2BFD1 Y2BNS9 Y2BPD2 Y2C6I4 Y2CBB7 Y2CMI1 Y2CPM1 Y2CTL0 Y2D8L9 Y2DA01 Y2DL63 Y2DPH2 Y2E067 Y2E8C4 Y2ED28 Y2EUP4 Y2EVA3 Y2F6R3 Y2FCE1 Y2FGJ6 Y2FJD4 Y2FVD2 Y2G9A3 Y2GLK9 Y2GMG2 Y2GXV1 Y2GYZ2 Y2HGW9 Y2HKR5 Y2HQC6 Y2JWC5 Y2K406 Y2KDE7 Y2KM65 Y2LLL4 Y2P0R9 Y2PTL6 Y2Q9L4 Y2QM99 Y2R1Z3 Y2R8R0 Y2S2T4 Y2S5T7 Y2SJG0 Y2SV89 Y2T0B0 Y2T7M8 Y2TN53 Y2U8Z8 Y2V0N5 Y2VGJ9 Y2XFE1 Y2YA34 Y2YEE2 Y2Z376 Y2ZT14 Y2ZXF4 Y2ZYP5 Y3A542 Y3ACP2 Y3AG91 Y3ATR2 Y3BIJ7 Y3BNQ9 Y3BQV4 Y3C1K4 Y3C954 Y3CEK0 Y3CLS3 Y3D553 Y3D687 Y3DIU8 Y3DLH0 Y3DST9 Y3ED50 Y3EF19 Y3EU44 Y3EZQ2 Y3F7I7 Y3FCI7 Y3FHX5 Y3FJE9 Y3FMZ0 Y3G1I9 Y3GKP4 Y3GN70 Y3GX21 Y3HBL6 Y3HC94 Y3HDG1 Y3HJE8 Y3HQF0 Y3I3M3 Y3IHK5 Y3J0W8 Y3J1G7 Y3J9Y3 Y3JN42 Y3JUG9 Y3K389 Y3K5I0 Y3K623 Y3KB20 Y3L0Q0 Y3L576 Y3L6D2 Y3LMV3 Y3LP19 Y3LQ71 Y3MD56 Y3MK27 Y3NN68 Y3P4N9 Y3P5Z2 Y3PAM4 Y3PHG3 Y3Q683 Y3Q940 Y3QFF3 Y3QRL8 Y3QZA3 Y3RDI7 Y3RIX8 Y3RVT3 Y3RWA1 Y3SFQ7 Y3SLI1 Y3SMH0 Y3SNK8 Y3T3V8 Y3T409 Y3TPE7 Y3TT89 Y3TX16 Y3TZM1 Y3UDF7 Y3URL9 Y3V8L3 Y3VBU5 Y3VGJ4 Y3VQ14 Y3VX01 Y3W9M7 Y3WL40 Y3WME0 Y3WNW3 Y3WQ16 Y3X063 Y3XLW2 Y3XVQ5 Y3Y2Q7 Y3Y4F7 Y3Y932 Y3YH76 Y3YVU8 Y3YZB7 Y3Z9P5 Y3ZF91 Y3ZT47 Y3ZTK7 Y4A4W4 Y4ABX1 Y4AW57 Y4AZ11 Y4B535 Y4BH19 Y4BL44 Y4BPI5 Y4BQQ9 Y4C360 Y4CLP1 Y4CQE0 Y4CUM2 Y4DA12 Y4DEF5 Y4DNH9 Y4E4T6 Y4EBD7 Y4EES9 Y4EW84 Y4EXC5 Y4EYW5 Y4F5G6 Y4FCR5 Y4FSN9 Y4FW21 Y4G966 Y4GG93 Y4GKI5 Y4H2W1 Y4H3B9 Y4HFP8 Y4HIY2 Y4HT86 Y4I5P6 Y4IH96 Y4IP07 Y4IQ93 Y4ITG0 Y4IUF2 Y4J9Z6 Y4JC33 Y4JS30 Y4K1V9 Y4KC55 Y4KD66 Y4KG91 Y4KGB7 Y4KKS5 Y4KXD0 Y4LM34 Y4LVF2 Y4M5B3 Y4MAZ3 Y4ME67 Y4MJW3 Y4N0P3 Y4NF08 Y4NHW9 Y4NIK4 Y4NVM0 Y4NVS6 Y4P650 Y4P9X2 Y4PRX8 Y4PV89 Y4Q4V6 Y4Q9K2 Y4QBN6 Y4QQ00 Y4QWV1 Y4R2G0 Y4RDG7 Y4RJ64 Y4RY86 Y4S4I5 Y4S535 Y4SSF2 Y4T0Q0 Y4T5C4 Y4TFC4 Y4TFH3 Y4TT17 Y4TUJ3 Y4U3D1 Y4UAY5 Y4UC68 Y4UIM4 Y4UMU2 Y4VBR4 Y4VJN6 Y4W2P1 Y4W3J8 Y4WLR1 Y4WML7 Y4X134 Y4X2G6 Y4X7V2 Y4XKH9 Y4XPQ5 Y4YF19 Y4YIH5 Y4YMB8 Y4YZL0 Y4ZJ44 Y4ZWN4 Y4ZZJ1 Y5A544 Y5ACV4 Y5AJ26 Y5APN4 Y5AQK8 Y5B2I0 Y5BE31 Y5BK53 Y5BNV3 Y5BR15 Y5CED8 Y5CH26 Y5CJ51 Y5CRX5 Y5CS54 Y5DBV1 Y5DR85 Y5DTF8 Y5E176 Y5E802 Y5EDV3 Y5EM32 Y5EMS3 Y5F0E2 Y5FSD2 Y5FTB3 Y5FVN9 Y5G4B9 Y5G6U7 Y5G9N6 Y5H7I1 Y5HB14 Y5HK21 Y5HQB5 Y5I3V9 Y5IDA2 Y5IP84 Y5IX75 Y5IY40 Y5J3F3 Y5JLT7 Y5JWV3 Y5JXZ3 Y5K4T9 Y5K5V2 Y5KPI7 Y5L0B7 Y5LSS3 Y5LV75 Y5M4C9 Y5M8V7 Y5MTL8 Y5MTV6 Y5N5R8 Y5NTW0 Y5P3Y5 Y5PK52 Y5PMI6 Y5PPQ7 Y5QKL6 Y5QMZ6 Y5QTC1 Y5RAJ1 Y5RIR9 Y5RP00 Y5RUG1 Y5S385 Y5S9E9 Y5SSS6 Y5SU16 Y5SXL0 Y5SXX1 Y5T5A1 Y5T8U9 Y5TW88 Y5TYU6 Y5TZW6 Y5UWQ8 Y5VC01 Y5VLN0 Y5VMD2 Y5VVU9 Y5WAR6 Y5WDX0 Y5WYI2 Y5X933 Y5XAM3 Y5XC88 Y5XMU5 Y5XZB1 Y5YE23 Y5YIJ6 Y5YX25 Y5YYK1 Y5ZAL2 Y5ZFH2 Y5ZIT2 Y5ZZQ7 Y6ARY8 Y6ATY1 Y6BKN8 Y6BSK2 Y6C9B5 Y6CDB3 Y6CEW7 Y6CNJ3 Y6CWM6 Y6D1I1 Y6DHA2 Y6DPE2 Y6E5H9 Y6EAJ3 Y6ECI8 Y6EH05 Y6F7Y7 Y6FC39 Y6FEX1 Y6FHG6 Y6G307 Y6GEI7 Y6GGT8 Y6GKC6 Y6H5D8 Y6H9M1 Y6HE84 Y6HHR1 Y6I5H1 Y6I6N7 Y6ICV3 Y6IT66 Y6J1X7 Y6J5Q1 Y6JRV3 Y6JYR1 Y6KJF6 Y6KXZ5 Y6LAB0 Y6LBN4 Y6M6R6 Y6MSL5 Y6N3I0 Y6NJF5 Y6NMF3 Y6PGA8 Y6PPK6 Y6QLB7 Y6QZV5 Y6R8L7 Y6RDD8 Y6RTW7 Y6SGE9 Y6SMZ0 Y6TIY5 Y6TV40 Y6U7D2 Y6U860 Y6V3G1 Y6VF93 Y6XJX7 Y6XNF0 Y6XT12 Y6XWZ6 Y6XYF1 Y6YSC3 Y6YSL5 Y6Z4K2 Y6Z4Z8 Y7ANI1 Y7B1A3 Y7BN58 Y7C8A1 Y7CFZ3 Y7CPK5 Y7CRU1 Y7DCZ7 Y7DML5 Y7DUZ1 Y7E8G0 Y7EAX3 Y7ECR4 Y7FQE0 Y7FSE5 Y7G1R0 Y7GEB4 Y7GZY6 Y7H9E6 Y7HCE4 Y7HCR9 Y7HMM4 Y7HYE9 Y7IHY6 Y7IJ88 Y7IL99 Y7IV29 Y7JZD7 Y7KDS5 Y7KMN3 Y7KU86 Y7L812 Y7LSY5 Y7M584 Y7MM30 Y7NHE0 Y7NJ53 Y7NKC7 Y7PYK0 Y7QA06 Y7QHN5 Y7QPU9 Y7RAG3 Y7RPC6 Y7RUQ8 Y7S5G4 Y7S9D9 Y7SS92 Y7SXL0 Y7THF8 Y7TP83 Y7TU67 Y7U3M5 Y7VAI7 Y7W6X4 Y7WI00 Y7WT45 Y7WXB9 Y7X350 Y7X6A7 Y7XMY7 Y7Y1C7 Y7YAP0 Y7YM67 Y7Z0L0 Y7Z367 Y7ZAY5 Y7ZLI5 Y8ABH9 Y8ACZ9 Y8AXW3 Y8B0F3 Y8B4M1 Y8B8Y1 Y8BVE2 Y8BVL2 Y8C019 Y8CGG7 Y8CIH3 Y8CKP5 Y8CWD7 Y8CXP1 Y8D871 Y8DHD7 Y8DZK0 Y8EC10 Y8EHY2 Y8ENN2 Y8FCJ2 Y8G3Z7 Y8G7Q9 Y8GSY6 Y8I5S5 Y8IBT9 Y8IE05 Y8J0Y2 Y8J8K4 Y8JBI1 Y8JIH0 Y8K736 Y8KMD3 Y8KZA4 Y8LGY6 Y8LKH9 Y8M728 Y8MAY9 Y8MB55 Y8MR18 Y8NAB0 Y8NIY4 Y8NML2 Y8PXW4 Y8QMB4 Y8S3E2 Y8S4N5 Y8SLE1 Y8T6X3 Y8TAJ5 Y8U8W1 Y8UZ35 Y8VDP0 Y8VU04 Y8W908 Y8XG49 Y8XJQ6 Y8XJS1 Y8XV08 Y8Y8F2 Y8YES5 Y8YLJ7 Y8YVH1 Y8ZCX1 Y8ZM50 Y8ZRA2 Y8ZXF3 Y9A0K7 Y9ACV5 Y9ARW1 Y9B4I9 Y9BE58 Y9BGM7 Y9BL06 Y9C9G8 Y9CQ48 Y9CWI3 Y9D672 Y9DAB9 Y9DB19 Y9DRT5 Y9EB45 Y9EGJ8 Y9EHN5 Y9ER51 Y9F5N9 Y9FBB5 Y9FFL5 Y9FUE9 Y9G013 Y9GNA8 Y9GSL9 Y9GTE3 Y9HJP7 Y9HNU0 Y9HWU9 Y9I0C4 Y9I0D1 Y9IDK9 Y9II45 Y9IZP2 Y9IZV6 Y9J0V5 Y9JZ59 Y9K0Y3 Y9K2Q0 Y9KT54 Y9KXC1 Y9LJ10 Y9LN95 Y9LQD7 Y9M8Q8 Y9MHS8 Y9MIE4 Y9MSE6 Y9MSI2 Y9NC93 Y9NFV4 Y9NSI4 Y9NWL1 Y9P273 Y9P4C0 Y9PT90 Y9PZK9 Y9Q040 Y9QC00 Y9QH34 Y9QLV0 Y9QSN0 Y9R0J0 Y9RA81 Y9RQ88 Y9SGM3 Y9SIV1 Y9SR08 Y9SS92 Y9TBW0 Y9THB3 Y9TL84 Y9U8Q8 Y9UIH5 Y9UIW1 Y9UKF8 Y9UTL3 Y9V3R4 Y9VDG8 Y9VE61 Y9VFR5 Y9W510 Y9WAV0 Y9WIA3 Y9WY89 Y9XGJ8 Y9XM41 Y9XP80 Y9XS43 Y9Y6E9 Y9Y926 Y9YBX7 Y9YPZ8 Y9YSV3 Y9Z2M6 Y9ZKQ2 Y9ZMX2 Y9ZWT4 Z0A4N6 Z0AF97 Z0ALA7 Z0ALY6 Z0AXJ7 Z0B880 Z0BLC9 Z0BPS6 Z0C8J8 Z0CEG6 Z0CNQ4 Z0CZN9 Z0D5Q1 Z0DET9 Z0DNE5 Z0DRT5 Z0DWF1 Z0E9Q8 Z0EHI4 Z0EMN8 Z0EW88 Z0F3R1 Z0FFH5 Z0FFW5 Z0G215 Z0G8L0 Z0GB37 Z0GIB0 Z0GQ06 Z0H0H7 Z0H1U7 Z0H4J6 Z0HLS7 Z0HUD0 Z0I3A3 Z0ILA7 Z0INN9 Z0J089 Z0J397 Z0JAC6 Z0JU26 Z0JY80 Z0K4W3 Z0KSJ0 Z0KVF1 Z0L0V6 Z0L7X3 Z0LFD2 Z0LYU8 Z0M057 Z0M644 Z0M764 Z0MFQ7 Z0MSR5 Z0MY17 Z0N3N3 Z0N6U0 Z0NG47 Z0NP58 Z0P3H1 Z0PHU2 Z0PR73 Z0PUW7 Z0QKD8 Z0QWR3 Z0QYS1 Z0R9V5 Z0RA90 Z0RGL0 Z0RSU1 Z0RX83 Z0S2F6 Z0SKH7 Z0SMM2 Z0SR08 Z0T6Y5 Z0TG55 Z0TJY2 Z0TPV9 Z0U3W9 Z0U8N2 Z0UFD1 Z0UID8 Z0VFS8 Z0VII6 Z0VPJ8 Z0W4S8 Z0WSE4 Z0X3P0 Z0XN04 Z0XUB1 Z0XX99 Z0Y4T4 Z0YBU0 Z0YKC1 Z0YL66 Z0YQB7 Z0ZG16 Z0ZNH2 Z0ZT84 Z0ZW54 Z1AC82 Z1ADE1 Z1AVY2 Z1AX01 Z1B0X7 Z1BH32 Z1BTQ7 Z1C1Y7 Z1C917 Z1CK57 Z1D3X6 Z1D979 Z1DD98 Z1DKN7 Z1DST4 Z1DUY6 Z1DWP7 Z1EGL4 Z1EKS0 Z1ENZ4 Z1EVC8 Z1F9D2 Z1FF13 Z1FPD7 Z1FRJ5 Z1G676 Z1G9V0 Z1GJW0 Z1GW11 Z1H380 Z1H4T6 Z1HC38 Z1HY58 Z1I0Y0 Z1I524 Z1IP31 Z1IW63 Z1IZN9 Z1J7W5 Z1JK33 Z1JYM7 Z1JYX2 Z1KDX7 Z1KTB7 Z1L0Y7 Z1L817 Z1LAL5 Z1LU47 Z1M2G4 Z1M5M5 Z1MKL9 Z1MNX7 Z1MQ24 Z1MWE0 Z1N653 Z1N801 Z1NL52 Z1P0U2 Z1P1A5 Z1P8Z5 Z1PDP0 Z1PKB6 Z1Q1E5 Z1Q8J4 Z1QT50 Z1QYN7 Z1R279 Z1RAL3 Z1RMA0 Z1RSS9 Z1S215 Z1S891 Z1SCB4 Z1SMV0 Z1T0B7 Z1T4L9 Z1TI54 Z1TIM7 Z1TZI1 Z1U0W1 Z1U3Y0 Z1UJD0 Z1UP20 Z1UT26 Z1VA45 Z1VDD9 Z1VNP9 Z1VY73 Z1W7Y3 Z1WDR1 Z1WR42 Z1WWA1 Z1XBM9 Z1XDS9 Z1XEP2 Z1XT79 Z1XXT1 Z1Y8H3 Z1YFM1 Z1YHE0 Z1Z0Z7 Z1Z4V6 Z1ZCC0 Z1ZGN0 Z1ZSV8 Z2A097 Z2ABQ4 Z2ADQ7 Z2AWT0 Z2AXF0 Z2AYN0 Z2B5E6 Z2BE03 Z2BMA3 Z2BV47 Z2C350 Z2C4J4 Z2CGT1 Z2FIL8 Z2G8F9 Z2GVP3 Z2GXP9 Z2H1P8 Z2HHH2 Z2HSM1 Z2HVC4 Z2IA94 Z2INL4 Z2IVM7 Z2J4X5 Z2JA62 Z2JQ35 Z2K5S0 Z2L7M9 Z2LK21 Z2M8N6 Z2MHH0 Z2MPF1 Z2N0M3 Z2NF65 Z2NFG3 Z2NXG7 Z2PEP8 Z2PRU7 Z2RHL8 Z2RMZ9 Z2RXG0 Z2SLR1 Z2T8U6 Z2UFL7 Z2V1F1 Z2V2J1 Z2VDG3 Z2W1T8 Z2W7Z8 Z2WSG8 Z2XMN5 Z2XXF6 Z2Y9X4 Z2YHK9 Z2YML3 Z2YTB2 Z2ZJH5 Z2ZP12 Z3A0X6 Z3A6P2 Z3A8Y6 Z3ASY4 Z3BUJ3 Z3BWI0 Z3CKE0 Z3CLB9 Z3CP13 Z3D0C5 Z3DMG1 Z3DPL6 Z3DXQ6 Z3EEN1 Z3EVX9 Z3EZL2 Z3FUY8 Z3GE61 Z3GVN5 Z3H5Q6 Z3I0T0 Z3I2K1 Z3ITM2 Z3IZE0 Z3J928 Z3JYG0 Z3K375 Z3KHB2 Z3KKQ2 Z3KT33 Z3L8U5 Z3LW09 Z3LYV9 Z3M082 Z3N622 Z3NEZ4 Z3NS75 Z3NT40 Z3NZA4 Z3PNF1 Z3PP17 Z3Q3Y4 Z3QBM5 Z3QU58 Z3QX50 Z3R6B0 Z3RCQ3 Z3RLI3 Z3SEY4 Z3SSV7 Z3TKU0 Z3UH41 Z3WUB7 Z3XZM2 Z3XZW5 Z3YC48 Z3YRB6 Z3YRU1 Z3Z5L6 Z3ZHU0 Z3ZPQ8 Z4A066 Z4AC10 Z4AJT4 Z4ALD7 Z4BFP2 Z4BLR1 Z4C2R7 Z4C382 Z4CFG6 Z4CHK0 Z4D0A5 Z4DJM2 Z4DKR6 Z4DUA9 Z4E566 Z4ENA2 Z4EWJ9 Z4EXL1 Z4F6G3 Z4FNP1 Z4GDG0 Z4GJP0 Z4HTK9 Z4IC68 Z4IMM2 Z4IUU3 Z4J893 Z4JJR0 Z4JQ19 Z4JTZ6 Z4K5H9 Z4KLN1 Z4KXE7 Z4L5F5 Z4LC53 Z4LCL5 Z4LN65 Z4M1G1 Z4MN18 Z4MR72 Z4N6E3 Z4NK36 Z4NMH4 Z4NYV5 Z4P537 Z4PHJ6 Z4PM48 Z4PZ95 Z4Q3D9 Z4QIR3 Z4R5H9 Z4RFE3 Z4SB58 Z4U1C5 Z5ZIQ7 Z6DBE5 Z6DIA0 Z6FVP4 Z6H428 Z6H9V9 Z6HML6 Z6IL39 Z6IN78 Z6J347 Z6KIY6 Z6KMC3 Z6KQ75 Z6L7V2 Z6LLB9 Z6LXB8 Z6M3D4 Z6MG26 Z6MZP8 Z6P2B3 Z6P4C3 Z6P7G2 Z6PTS1 Z6PZW8 Z6Q4L0 Z6QFG5 Z6QFX3 Z6QNI4 Z6RC35 Z6RHB9 Z6RN59 Z6RZR9 Z6S351 Z6SBJ2 Z6SJD0 Z6STM6 Z6T4W5 Z6TQP4 Z6U8J6 Z6UAS7 Z6USE9 Z6V1T0 Z6VAB0 Z6VT54 Z6W5K7 Z6WFQ6 Z6WKM1 Z6WU73 Z6X0H0 Z6XY48 Z6Y910 Z6YDM2 Z6YRB3 Z6YRS5 Z6YZL7 Z7AH46 Z7B2N9 Z7BIK2 Z7C218 Z7CLR2 Z7D7T2 Z7DIM9 Z7DJ48 Z7E1E1 Z7EG75 Z7EYU5 Z7FNQ9 Z7G0G5 Z7G0Q1 Z7G851 Z7GJ52 Z7GYM5 Z7H0P0 Z7HB01 Z7HM04 Z7HXH4 Z7I5D9 Z7IQU0 Z7ITL2 Z7JAN4 Z7JFH2 Z7JSY4 Z7K4X7 Z7KAE7 Z7KN51 Z7MZE4 Z7N4E8 Z7NHS1 Z7NMH4 Z7NY80 Z7P3L2 Z7PFT0 Z7PKN3 Z7PS89 Z7PVW7 Z7Q3D8 Z7QLI9 Z7QP63 Z7QRC6 Z7R338 Z7R6A5 Z7REA3 Z7RTR2 Z7RY19 Z7S587 Z7S7V8 Z7SIW7 Z7SV54 Z7SZF6 Z7T7N6 Z7TDM8 Z7TNX0 Z7TUR0 Z7UCT4 Z7UPR8 Z7VC07 Z7VEJ7 Z7VPH0 Z7VYY1 Z7W119 Z7WBT9 Z7WPB8 Z7X342 Z7X658 Z7XET4 Z7XGK8 Z7XS44 Z7Y628 Z7Y7J4 Z7YLX8 Z7YVL4 Z7Z8V7 Z7ZDV6 Z7ZVS5 Z7ZXT6 Z8ABX9 Z8B5F7 Z8BEM1 Z8BIQ0 Z8BVB2 Z8C5U7 Z8C5Y7 Z8CQJ5 Z8CWN8 Z8D506 Z8DHR8 Z8E0S9 Z8E608 Z8ELA5 Z8EV44 Z8F384 Z8FVD4 Z8G7A6 Z8GCU2 Z8GFS2 Z8GQC9 Z8GW80 Z8H1W7 Z8HCC5 Z8HHQ3 Z8HMY5 Z8HXV9 Z8ICU4 Z8IIA3 Z8J120 Z8J3S9 Z8JBB7 Z8JHA5 Z8JP89 Z8JYQ3 Z8K2H0 Z8KHN9 Z8KSY4 Z8L7Q5 Z8LC99 Z8LED6 Z8LMZ4 Z8ME09 Z8MK57 Z8MTX6 Z8N9K3 Z8NDL9 Z8NRG3 Z8NW27 Z8P6W8 Z8PDS5 Z8PJ59 Z8PRR9 Z8PZH6 Z8QAW4 Z8QB54 Z8QM87 Z8QTM2 Z8R2I4 Z8R844 Z8RIT6 Z8RU47 Z8SAD4 Z8SGB1 Z8SL18 Z8SY38 Z8T155 Z8TBE1 Z8TFM3 Z8TSH4 Z8TYH8 Z8UGP0 Z8UUI3 Z8UWK2 Z8V838 Z8V9E1 Z8VMR2 Z8W0M0 Z8W7V4 Z8WDU2 Z8WF23 Z8WVZ7 Z8X146 Z8XA84 Z8XL90 Z8XYV8 Z8Y677 Z8YJ42 Z8YS62 Z8Z366 Z8Z6I3 Z8ZFT9 Z8ZQJ6 Z8ZX04 Z9A7D5 Z9AF84 Z9ANI8 Z9CJY5 Z9CR70 Z9D1I5 Z9DYW1 Z9E9V1 Z9EIU5 Z9EKK3 Z9EQA5 Z9FMJ1 Z9FQ67 Z9FQD7 Z9GHH5 Z9HK41 Z9HKL9 Z9KL19 Z9L1P2 Z9N8S4 Z9NN46 Z9NPH1 Z9NWR3 Z9QV33 Z9R4C7 Z9TZC8 Z9V514 Z9VY62 Z9W2Z2 Z9WS40 Z9XEN7 Z9XSM5 Z9Y8G0 Z9YQ20 Z9ZMZ6
gi|387149562|ref|YP_005741126.1| gi|269202025|ref|YP_003281294.1| gi|15923368|ref|NP_370902.1| gi|15926079|ref|NP_373612.1| gi|470192564|ref|YP_007578917.1| gi|470222053|ref|YP_007620610.1| gi|386830048|ref|YP_006236702.1| gi|470190599|ref|YP_007576909.1| gi|150392910|ref|YP_001315585.1| gi|148266864|ref|YP_001245807.1| gi|156978706|ref|YP_001440965.1| gi|384863732|ref|YP_005749091.1| gi|470224018|ref|YP_007622597.1| gi|537460121|ref|YP_008490561.1| jgi|Aspzo1|145361|fgenesh1_pg.16_#_45 gi|470198460|ref|YP_007584860.1| 158878.SAV0378 158879.SA0363 359786.SaurJH9_0426 359787.SaurJH1_0437 418127.SAHV_0375 681288.SAAV_0345 gi|470218230|ref|YP_007618624.1| gi|470194529|ref|YP_007580881.1| gi|470196495|ref|YP_007582896.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]