SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H8KPZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H8KPZ2
Domain Number 1 Region: 32-255
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.77e-30
Family Prokaryotic proteases 0.0018
Further Details:      
 
Domain Number 2 Region: 434-507
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000116
Family HtrA-like serine proteases 0.046
Further Details:      
 
Domain Number 3 Region: 341-420,524-581
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000554
Family Prokaryotic proteases 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H8KPZ2
Sequence length 588
Comment (tr|H8KPZ2|H8KPZ2_SOLCM) Trypsin-like serine protease with C-terminal PDZ domain {ECO:0000313|EMBL:AFD06101.1} KW=Complete proteome; Reference proteome OX=929556 OS=NCIMB 12057 / USAM 9D) (Flexibacter canadensis). GN=Solca_0991 OC=Sphingobacteriaceae; Solitalea.
Sequence
MLSCYLYLLSGVRFSSLNQFLVNYPLKMFFKKIFSFCCCLLIYLQGFGQEIRNAEQIEKL
TSRVVESTLSSCVQIAAYDTVRKRASTAVFSGVVVSAEGHILTVAHTTKPNQIYQIHFPN
GKKHLAIGLGRISIRNDSTDLDLAMIKLNGFESWSFTKMGQSAGLKANQPCVGISYPGTF
EKNMPNIRFGRLTNPKSKAGYIESTCKMEPGDSGGPLFNLNGEVIAIHSWIANGIDENFE
IPVDLYKKYWSALNSAIDYKEVPKADNATVSHLSSTVNTLLIPITDELASFPYHLKGSSV
LVTSNMEGHPQMIQGTVISYKSDQKRSIFIISKNSMVAENPVVQQNGKMFPVDVIWKDRD
NDLVLLRPSIRLKNGIELQKQSSSVELTQKDLGKILVSSTSHDNKRVGVLSSTYIEMPLR
FSRGYFGANATFINKKIVITQLASGSPAASVLKLDDQVTDINGVSIDQPIDYGSELMKYC
AGDSITVDIVRSGIPARFKIFLPPYPRQIKEAKQFGEVRSFRSDAFKKVLVWDADEKVEE
CGAPVFDTKGEFYGINIARHSRTSSIIMPVNFIIKLLENGIQNIEKQN
Download sequence
Identical sequences H8KPZ2
gi|387790212|ref|YP_006255277.1| WP_014679329.1.74489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]