SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3L273 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3L273
Sequence length 518
Comment (sp|I3L273|GFY_HUMAN) Protein Goofy KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GFY; OC=Catarrhini; Hominidae; Homo.
Sequence
MKSFSRILFLVFLLAGLRSKAAPSAPLPLGCGFPDMAHPSETSPLKGASENSKRDRLNPE
FPGTPYPEPSKLPHTVSLETFPLDFTEPLNPDLRETPHPESPETPKADSLTTSISESLDM
PKTNLSKMAHPESSETPTPGPTEMPHPGSPETPKPNFSKTSRPEFPETPNTDLMQTTPQE
SPEILQLNATEVSQAELPETSNTNPTKTPDPKSPEKHDLNSTETPNSEFLQALHPDPSKT
PHPESHVTHNPSPTEISQTEFPTTYYQNATDVPRTSDPQISTSLYPETPVPFKDDATALN
ELSLNPKPGTPAAIQPDSPKLPTSDSPGMVELKAPQNSGPKESNVPPPSARIAGPPALPG
RPSQLAPATLRAPQRHSRGEGVNTIIVVERVKETGVTLVGRPRGAAGGALCLFFAGTALL
IGIFVLLWCLYRRAARQRPFAHHRLPDDGDEPVLHLDAPKDPYDLYFYAPDTWVPSHIAT
KQPPPTPPLPPKLPPPPRGGRPQRLEALSPATLPNNFV
Download sequence
Identical sequences I3L273
gi|305410848|ref|NP_001182185.1| ENSP00000459439 ENSP00000478493 ENSP00000459439 NP_001182185.1.87134 NP_001182185.1.92137 XP_011524601.1.92137 ENSP00000459439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]