SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7WK44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7WK44
Domain Number 1 Region: 816-1133
Classification Level Classification E-value
Superfamily TPR-like 3.41e-59
Family Tetratricopeptide repeat (TPR) 0.00026
Further Details:      
 
Domain Number 2 Region: 562-836
Classification Level Classification E-value
Superfamily TPR-like 1.02e-51
Family Tetratricopeptide repeat (TPR) 0.00052
Further Details:      
 
Domain Number 3 Region: 291-425,454-514
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.21e-28
Family Prokaryotic proteases 0.012
Further Details:      
 
Domain Number 4 Region: 45-221
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-20
Family Prokaryotic proteases 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7WK44
Sequence length 1150
Comment (tr|K7WK44|K7WK44_9NOST) TPR repeat-containing protein {ECO:0000313|EMBL:AFW95968.1} KW=Complete proteome; Reference proteome OX=46234 OS=Anabaena sp. 90. GN=ANA_C13292 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MKRQIAIISCLLLLPYPVSAIETQIKTTKLLTQSSQRCKLRPANPENGIYSEPQLQTIAK
QITVRVRDKERGASGTIFARKDNSYLVVTNSHVVRRINNINIITADGQKYAGKILPNTNF
DKFDLAIVEFTSNQKYCLPSEIADRIASFDINLETPVMAAGYAVSEDKLVLTTGKIQQII
SQPSLKYGYEIGYTSDIQQGMSGGAIISNTGNFIGINGISSYPLSNSAYTYTNGKRPTNT
EIQEFRKLSWGIPIKTVLGQVKLEVLTAYNLPIPDIKQQIAEVPLTGWLGELEAKAKQIT
VRIDSSSGANGSGIIIAKEGDIYTVLTAAHVVCKPPDKVGPCEPNTYKILTVDGKQYPVE
PSTIKLEEGVDLAVVKFTSRENYQVATLANYPIKDDEYMFTAGYPRLGEKSPWRFTLGQI
YSKETGLLATTQSDFNNNSSGTAQSAISLTGGYELVYSSITFGGMSGGPVLDSQGRVIGI
HGRTEGQAAIDNNSNSKETIQLGNSLGIPVSTFLALATRLNTQAQKIETTPPPELNQQKV
KSIQTAILSVDVSQGNTTASQWLERGNQLWRLRRYPEAIQAFDAAINQKPKFIHLAYYGK
GLALGSSGKYPEAITALQQAVKSQPDFVPAWDYLSSVYRESNQLDKALAAINQAIQLQPN
NPNLYNQKRGVLSDLKKYKEAAAAINKAIELSPRAAFYYNQGIVRYELGDKPGAIDDYTQ
AIKINPNYAKAYNNRGIVRNELGDKPGAIDDYNQAIRINPNYALAYYNRGNVRYELGDKQ
GAIDDYTLAIKINPNYANAYYNRGIVRYELGDKPGAIDDYNLAIKFNPNYAQAYYNRGIV
RDDLGDKPGAIDDYNQAIKFNPNDAQAYYNRGIVRYELGDKPGAIDDYTQAIKFNPNDAN
AYYGRGSVRNDLGDKQGAIDDYTQAIKFNPNDANAYYGRGSVRNDLGDKQGAIDDYTQAI
KFNPNDANAYYNRGFVRNELGDKQGAIDDYTLAIKYNPNYAAYYNRGIVRNELGDKQGAI
DDYTLAIKYNPNYAAYYNRGIVRNELGDKQGAIDDYTLAIKINPNYADAYYNRGFVRNEL
GDKQGAIDDYTLAIKYNPNYAQAYVRRGSVRYQLGDKPGAKEDLQRAAQLFKDQGNTAAY
EQTMAFLKEL
Download sequence
Identical sequences K7WK44
gi|414078463|ref|YP_006997781.1| WP_015081111.1.50365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]