SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9RDE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9RDE6
Domain Number 1 Region: 538-823
Classification Level Classification E-value
Superfamily TPR-like 1.77e-33
Family Tetratricopeptide repeat (TPR) 0.0045
Further Details:      
 
Domain Number 2 Region: 276-410,439-494
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.46e-29
Family Prokaryotic proteases 0.0041
Further Details:      
 
Domain Number 3 Region: 39-259
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.22e-26
Family Prokaryotic proteases 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9RDE6
Sequence length 826
Comment (tr|K9RDE6|K9RDE6_9CYAN) TPR repeat-containing protein {ECO:0000313|EMBL:AFY55339.1} KW=Complete proteome; Reference proteome OX=373994 OS=Rivularia sp. PCC 7116. GN=Riv7116_2842 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Rivularia.
Sequence
MNRNLILLSSLFLLQFPTSPIKAAPPSIAQNSICQIERENEEYSTKELQTLANKITVKII
GDNNGGSGTLIGKQGNNYLVLTNSHVIQGVNSIKLQTADGKTYSAEIIPQKNFKNSDITL
LKFQSSQSYCFAEVSTATPDINTNILAAGFSGSTGNIVFSEGEVKKTSNLKEGYEIGYSS
NIEQGMSGGAILNSMGELVGINGKSAYPILNTGYVYQNGKRPSEAEITEMRKLSWGIPIS
TVLAWVDSDLLTAYKLPLPEGGAAIPEPEYTGWLGELEQKAKQFTVRIDSSSTANGSGII
IAKEGNTYTVLTSAHVLCESENGTPPCPGNIYEILAPDGDKYAADKSSIKIESGVDLAVV
KFKSSENYEIATLADYNPNEGNYIFTAGYPKLKNDSPWRFTVGQIFDKDFGLTRTKQSDF
QNYNFGKLQRASSLTGGYELVYTSITYGGMSGGPVLNWQGRVIGIHGRTEGTEGDFQIGY
SLGIPVSTFLGVVPRLSVKPPNLENTRPPRLNAQKNKLIEKAILSVDVSKGNASASQWLE
RGNQLWRLRRNEEAVKAFDEAINQKPAFVHLAFYGKSLALAQQSKSREAIAALNQAVKLK
SNFVAAWQTLSSFNSSIGELDKALIAIDKAIKLQPKNPNLYYEKSKVLTYLKQYKEAEIA
IKQAIKLSPRALFYLNWGNLYKNNTNKKWDLALPHYNKAIQINPKSGIAYLTRGHFYYFQ
QKWDLALADFNKLIQINFADNIAYLRRGYIYSYQKKWDLALANFNKFIQMDRKFALAYQN
RALVLIEIGNKQKAIQDLQKAAQLYKSKNNTTRYEQVINLLQQLQQ
Download sequence
Identical sequences K9RDE6
gi|427736342|ref|YP_007055886.1| WP_015118908.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]