SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9VTP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9VTP0
Domain Number 1 Region: 742-1079
Classification Level Classification E-value
Superfamily TPR-like 1.39e-75
Family Tetratricopeptide repeat (TPR) 0.0003
Further Details:      
 
Domain Number 2 Region: 546-821
Classification Level Classification E-value
Superfamily TPR-like 5.88e-49
Family Tetratricopeptide repeat (TPR) 0.0033
Further Details:      
 
Domain Number 3 Region: 12-216
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.02e-27
Family Prokaryotic proteases 0.0024
Further Details:      
 
Domain Number 4 Region: 280-408,439-503
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.9e-27
Family Prokaryotic proteases 0.014
Further Details:      
 
Domain Number 5 Region: 1045-1165
Classification Level Classification E-value
Superfamily TPR-like 4.74e-23
Family Tetratricopeptide repeat (TPR) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9VTP0
Sequence length 1192
Comment (tr|K9VTP0|K9VTP0_9CYAN) Tetratricopeptide TPR_1 repeat-containing protein {ECO:0000313|EMBL:AFZ11448.1} KW=Complete proteome; Reference proteome OX=1173022 OS=Crinalium epipsammum PCC 9333. GN=Cri9333_0484 OC=Gomontiellaceae; Crinalium.
Sequence
MNNRTLTLISCLLLLSTPVITASAIYAQQPNLTAPDDVPPPIPLQEKEKIAAEITVKISS
GNNGGSGVLIAKKQQTYLVLTNAHVVDNSKNLQISTPDGKIYTAQLVPNSKLGNYDLALL
QFTSNKEYSIAQYDPSNLPRMNGDILAVGFSGESGKLVYRPGKITYLPERSLKQGYGLGY
NSNVVQGMSGGAILNEYGELIGINGRSSYPILNSGYVYEDNAKPTPAEVQKLRGSSWGIS
LQTFLAQLPQDFARAYSFPQPPISIPDVNNEPELTGWLGQLNEQARKFTVRINNKNDDRD
SGSGVIIAKQNNTYYVLTCAHVIKNSTNYEIVTPDGKIYSVDYSRVRKEEGVDLAVVQFN
SNDSYQVATIGNVAAKDEQYTFVTGYSKFGNKQSQWRFSPGDISEQEVGLLRVKNYRVEG
RNQSAVAAESAISLTGGYELVYRNITYGGMSGGAVLDSLGRVIGIHGSAEGEIAIDDSSS
DLNKLQFGYSLGIPAKTFLGIANRLQVNSGLLKVENSPPPDLNAVQQDAVKKTILTVGVP
QGNAKASVWLQRGNQLWRLRRYDEAIAAFDAAIKLQPAFVHLAWYGRGLVLYAQKKYSEA
SVAISTAISKKPDYYPALKLQSQVLTQLKQLDEALVAIEKAIVIQPQDPNLYFIKTSILS
DLKRYPEAIATIQKGIDISPRAALYWIRGNVYVNQKQWDKAINDYNTAIKINPQYANAYL
MRGGVYSDQKQWDKAIDDYNTAIKINPQYANAYLMRGDVYSDQKQWDKAIDDYNTAIKIN
SNNAWAYSARGLVYYKQKQWNKAIDDYNTAIKINPGDAFAYSARGLVYKEQKQWDKAIDD
YTTAIKINPQYADAYSLRGRVHDQQKQWDKAIDDFTTAIKINPNNANDYSLRGLVYVNQK
QWDKAIDDFTTAIKINPHDAGAYSVRGLVYQEQKQWDKAIDDFKSAIKINPGDASAYLSR
GEVYSYQKQWDKAIDDFKSAIKINPNDALAYYNRGNVYVNQKQWDLAINDYNSAIKINPQ
YAEAYYNRGIVYSNQKKWELALADWNQAIKINPKFAEAYFNRGFVYHTQENYSAALSDYK
QALSINENLIAAISNIGFINYEMGETEAAIQQWQKVVKVDSQQAEPQLALAVAMYTKGES
DKGVQLAAQALKLDKQFADVAYLKQNLWGKRIIADTQKLFADAKMKAVLAGL
Download sequence
Identical sequences K9VTP0
WP_015201584.1.21814 gi|428304133|ref|YP_007140958.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]