SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O00292 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O00292
Domain Number 1 Region: 256-353
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.34e-17
Family Transforming growth factor (TGF)-beta 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) O00292
Sequence length 366
Comment (sp|O00292|LFTY2_HUMAN) Transforming growth factor beta-4 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=LEFTY2; OC=Catarrhini; Hominidae; Homo.
Sequence
MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQ
YVVLLRRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRL
FQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDV
TEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTL
DLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQP
PEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALV
PRRLQP
Download sequence
Identical sequences A0A024R3P5 H2Q183 O00292
ENSP00000355785 ENSP00000355785 ENSP00000355785 NP_003231.2.87134 NP_003231.2.92137 XP_003814962.1.60992 XP_514238.2.37143 gi|27436881|ref|NP_003231.2| ENSPTRP00000003446 9598.ENSPTRP00000003450 9606.ENSP00000355785 ENSPTRP00000003450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]