SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O00744 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O00744
Sequence length 389
Comment (sp|O00744|WN10B_HUMAN) Protein Wnt-12 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=WNT10B; OC=Catarrhini; Hominidae; Homo.
Sequence
MLEEPRPRPPPSGLAGLLFLALCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSP
GPGSSPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
Download sequence
Identical sequences G3R6M5 H2Q5U3 O00744
NP_003385.2.87134 NP_003385.2.92137 XP_004053109.1.27298 XP_016778996.1.37143 XP_016778997.1.37143 XP_016778998.1.37143 XP_016778999.1.37143 XP_016779000.1.37143 XP_509037.3.37143 ENSP00000301061 ENSP00000301061 gi|16936522|ref|NP_003385.2| ENSP00000301061 ENSGGOP00000010987 9606.ENSP00000301061 ENSGGOP00000010987 NYSGXRC-13079a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]