SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O00757 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O00757
Domain Number 1 Region: 5-330
Classification Level Classification E-value
Superfamily Carbohydrate phosphatase 1.7e-111
Family Inositol monophosphatase/fructose-1,6-bisphosphatase-like 0.000000000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O00757
Sequence length 339
Comment (sp|O00757|F16P2_HUMAN) Muscle FBPase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FBP2; OC=Catarrhini; Hominidae; Homo.
Sequence
MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGI
AGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDP
LDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQ
GVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAP
YGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGT
QPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS
Download sequence
Identical sequences O00757
9606.ENSP00000364486 ENSP00000364486 ENSP00000364486 ENSP00000364486 gi|22907028|ref|NP_003828.2| NP_003828.2.87134 NP_003828.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]