SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O02380 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O02380
Domain Number 1 Region: 16-139
Classification Level Classification E-value
Superfamily E set domains 2.24e-33
Family ML domain 0.0000688
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O02380
Sequence length 141
Comment (sp|O02380|ALL2_TYRPU) Mite group 2 allergen Tyr p 2 OX=59818 OS=Tyrophagus putrescentiae (Mold mite) (Acarus putrescentiae). GN= OC=Tyrophaginae; Tyrophagus.
Sequence
MKFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQD
TCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVK
LLATGEHGVLACGAVNTDVKP
Download sequence
Identical sequences O02380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]