SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O14581 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O14581
Domain Number 1 Region: 1-308
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.57e-91
Family Rhodopsin-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O14581
Sequence length 309
Comment (sp|O14581|OR7AH_HUMAN) Olfactory receptor 7A17 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=OR7A17; OC=Catarrhini; Hominidae; Homo.
Sequence
MEPENDTGISEFVLLGLSEEPELQPFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMY
FFLSNLSFADICFISTTIPKMLINIQTQSRVITYAGCITQMCFFVLFGGLDSLLLAVMAY
DRFVAICHPLHYTVIMNPRLCGLLVLASWMIAALNSLSQSLMVLWLSFCTDLEIPHFFCE
LNQVIHLACSDTFLNDMGMYFAAGLLAGGPLVGILCSYSKIVSSIRAISSAQGKYKAFST
CASHLSVVSLFCCTGLGVYLTSAATHNSHTSATASVMYTVATPMLNPFIYSLRNKDIKRA
LKMSFRGKQ
Download sequence
Identical sequences A0A126GVR5 O14581
gi|13775162|ref|NP_112163.1| ENSP00000328144 NP_112163.1.87134 NP_112163.1.92137 9606.ENSP00000328144 ENSP00000328144 ENSP00000328144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]