SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O14681 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O14681
Sequence length 340
Comment (sp|O14681|EI24_HUMAN) p53-induced gene 8 protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=EI24; OC=Catarrhini; Hominidae; Homo.
Sequence
MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERK
QESEPRIVSRIFQCCAWNGGVFWFSLLLFYRVFIPVLQSVTARIIGDPSLHGDVWSWLEF
FLTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLL
QALFLIQGMFVSLFPIHLVGQLVSLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWP
YYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKAYLFQLRLFSLVVFL
SNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATAGH
Download sequence
Identical sequences A0A024R3I8 O14681
gi|55956766|ref|NP_004870.3| NP_004870.3.87134 NP_004870.3.92137 XP_011541371.1.92137 ENSP00000278903 ENSP00000484510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]