SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O14776 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O14776
Domain Number 1 Region: 783-846
Classification Level Classification E-value
Superfamily FF domain 1.57e-16
Family FF domain 0.0000214
Further Details:      
 
Domain Number 2 Region: 653-718
Classification Level Classification E-value
Superfamily FF domain 9.42e-16
Family FF domain 0.0000173
Further Details:      
 
Domain Number 3 Region: 716-778
Classification Level Classification E-value
Superfamily FF domain 0.00000000000000445
Family FF domain 0.0033
Further Details:      
 
Domain Number 4 Region: 888-959
Classification Level Classification E-value
Superfamily FF domain 0.0000000000000115
Family FF domain 0.0000104
Further Details:      
 
Domain Number 5 Region: 954-1011
Classification Level Classification E-value
Superfamily FF domain 0.0000000000419
Family FF domain 0.0043
Further Details:      
 
Domain Number 6 Region: 434-466
Classification Level Classification E-value
Superfamily WW domain 0.00000000046
Family WW domain 0.00032
Further Details:      
 
Domain Number 7 Region: 136-168
Classification Level Classification E-value
Superfamily WW domain 0.000000000682
Family WW domain 0.0011
Further Details:      
 
Domain Number 8 Region: 523-561
Classification Level Classification E-value
Superfamily WW domain 0.0000000668
Family WW domain 0.0036
Further Details:      
 
Weak hits

Sequence:  O14776
Domain Number - Region: 1015-1080
Classification Level Classification E-value
Superfamily FF domain 0.0089
Family FF domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) O14776
Sequence length 1098
Comment (sp|O14776|TCRG1_HUMAN) Transcription factor CA150 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TCERG1; OC=Catarrhini; Hominidae; Homo.
Sequence
MAERGGDGGESERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPPLMRPPPPFGMMRGPP
PPPRPPFGRPPFDPNMPPMPPPGGIPPPMGPPHLQRPPFMPPPMSSMPPPPGMMFPPGMP
PVTAPGTPALPPTEEIWVENKTPDGKVYYYNARTRESAWTKPDGVKVIQQSELTPMLAAQ
AQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ
AQVQAQVQAQVQAQAVGASTPTTSSPAPAVSTSTSSSTPSSTTSTTTTATSVAQTVSTPT
TQDQTPSSAVSVATPTVSVSTPAPTATPVQTVPQPHPQTLPPAVPHSVPQPTTAIPAFPP
VMVPPFRVPLPGMPIPLPGVAMMQIVSCPYVKTVATTKTGVLPGMAPPIVPMIHPQVAIA
ASPATLAGATAVSEWTEYKTADGKTYYYNNRTLESTWEKPQELKEKEKLEEKIKEPIKEP
SEEPLPMETEEEDPKEEPIKEIKEEPKEEEMTEEEKAAQKAKPVATAPIPGTPWCVVWTG
DERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQEPPHKKGMEELKKLRHPTPTMLSIQKW
QFSMSAIKEEQELMEEINEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKAARERAIVPLE
ARMKQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLLNPKERKQVFDQYVKTRAEEERRE
KKNKIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAA
RKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKVKDKVESDPRYKAVDSSSMREDLF
KQYIEKIAKNLDSEKEKELERQARIEASLREREREVQKARSEQTKEIDREREQHKREEAI
QNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGSLLEREEKEKLFNEHIEALTKKKREH
FRQLLDETSAITLTSTWKEVKKIIKEDPRCIKFSSSDRKKQREFEEYIRDKYITAKADFR
TLLKETKFITYRSKKLIQESDQHLKDVEKILQNDKRYLVLDCVPEERRKLIVAYVDDLDR
RGPPPPPTASEPTRRSTK
Download sequence
Identical sequences A0A2I3RJ71 G3QLC8 O14776
ENSP00000296702 ENSGGOP00000003277 ENSP00000296702 HR4802 NP_006697.2.87134 NP_006697.2.92137 XP_004042807.1.27298 9606.ENSP00000296702 gi|21327715|ref|NP_006697.2| ENSGGOP00000003277 ENSP00000296702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]