SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O14894 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O14894
Sequence length 197
Comment (sp|O14894|T4S5_HUMAN) Tetraspan transmembrane protein L6H KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TM4SF5; OC=Catarrhini; Hominidae; Homo.
Sequence
MCTGKCARCVGLSLITLCLVCIVANALLLVPNGETSWTNTNHLSLQVWLMGGFIGGGLMV
LCPGIAAVRAGGKGCCGAGCCGNRCRMLRSVFSSAFGVLGAIYCLSVSGAGLRNGPRCLM
NGEWGYHFEDTAGAYLLNRTLWDRCEAPPRVVPWNVTLFSLLVAASCLEIVLCGIQLVNA
TIGVFCGDCRKKQDTPH
Download sequence
Identical sequences O14894
9606.ENSP00000270560 gi|21265113|ref|NP_003954.2| ENSP00000270560 ENSP00000270560 ENSP00000270560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]