SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O15273 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) O15273
Sequence length 167
Comment (sp|O15273|TELT_HUMAN) Titin cap protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TCAP; OC=Catarrhini; Hominidae; Homo.
Sequence
MATSELSCEVSEENCERREAFWAEWKDLTLSTRPEEGCSLHEEDTQRHETYHQQGQCQVL
VQRSPWLMMRMGILGRGLQEYQLPYQRVLPLPIFTPAKMGATKEEREDTPIQLQELLALE
TALGGQCVDRQEVAEITKQLPPVVPVSKPGALRRSLSRSMSQEAQRG
Download sequence
Identical sequences A2TDC0 O15273
ENSP00000312624 ENSP00000312624 9606.ENSP00000312624 ENSP00000312624 GO.36757 HR183 gi|4507435|ref|NP_003664.1| NP_003664.1.87134 NP_003664.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]