SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O15318 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O15318
Sequence length 223
Comment (sp|O15318|RPC7_HUMAN) RNA polymerase III 32 kDa subunit KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=POLR3G; OC=Catarrhini; Hominidae; Homo.
Sequence
MAGNKGRGRAAYTFNIEAVGFSKGEKLPDVVLKPPPLFPDTDYKPVPLKTGEGEEYMLAL
KQELRETMKRMPYFIETPEERQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAG
PKPKKAKDAGKGTPLTNTEDVLKKMEELEKRGDGEKSDEENEEKEGSKEKSKEGDDDDDD
DAAEQEEYDEEEQEEENDYINSYFEDGDDFGADSDDNMDEATY
Download sequence
Identical sequences A0A024RAM1 O15318
gi|115529475|ref|NP_006458.2| ENSP00000424970 ENSP00000382058 ENSP00000421637 9606.ENSP00000382058 NP_006458.2.87134 NP_006458.2.92137 XP_005248461.1.92137 XP_011541402.1.92137 XP_011541403.1.92137 XP_011541404.1.92137 XP_016864446.1.92137 ENSP00000382058 ENSP00000421637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]