SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O24172 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O24172
Domain Number 1 Region: 1-50
Classification Level Classification E-value
Superfamily Pollen allergen ole e 6 1.24e-27
Family Pollen allergen ole e 6 0.0000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O24172
Sequence length 50
Comment (sp|O24172|ALL6_OLEEU) Major pollen allergen Ole e 6 OX=4146 OS=Olea europaea (Common olive). GN=OLE6; OC=Pentapetalae; asterids; lamiids; Lamiales; Oleaceae; Oleeae; Olea.
Sequence
DEAQFKECYDTCHKECSDKGNGFTFCEMKCDTDCSVKDVKEKLENYKPKN
Download sequence
Identical sequences O24172
1ss3.A 000008573|e1ss3A1|397.3.1.1|A:1-50 cath|current|1ss3A00/1-50 d1ss3a_ 1ss3A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]