SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O43184 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O43184
Domain Number 1 Region: 212-414
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.04e-64
Family Reprolysin-like 0.00000365
Further Details:      
 
Domain Number 2 Region: 433-508
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 4.06e-22
Family Blood coagulation inhibitor (disintegrin) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 2.054 168.98
endopeptidase activity 1.571 151.3
zinc ion binding 1.527 42.04
cytokine receptor binding 1.974 16.02
growth factor receptor binding 2.188 16.02
enzyme activator activity 1.431 14.69
integrin binding 1.56 12.29
peptide transporter activity 1.665 9.96
amide binding 1.538 9.47
protein kinase binding 1.492 9.19
Cellular Component IC (bits) H-Score
cell surface 1.3 10.4
neuron projection terminus 2.125 9.05
exocytic vesicle 2.03 8.34
Golgi-associated vesicle 2.091 6.62
vacuolar part 1.567 6.28
dendrite 1.582 5.69
host cell part 1.996 5.41
lysosomal membrane 1.946 5.05
endocytic vesicle 1.532 4.85
cytoplasmic vesicle part 1.417 4.7

Protein sequence

External link(s) O43184
Sequence length 909
Comment (sp|O43184|ADA12_HUMAN) Meltrin-alpha KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ADAM12; OC=Catarrhini; Hominidae; Homo.
Sequence
MAARPLPVSPARALLLALAGALLAPCEARGVSLWNQGRADEVVSASVGSGDLWIPVKSFD
SKNHPEVLNIRLQRESKELIINLERNEGLIASSFTETHYLQDGTDVSLARNYTVILGHCY
YHGHVRGYSDSAVSLSTCSGLRGLIVFENESYVLEPMKSATNRYKLFPAKKLKSVRGSCG
SHHNTPNLAAKNVFPPPSQTWARRHKRETLKATKYVELVIVADNREFQRQGKDLEKVKQR
LIEIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQDPFTSLHEFLDWRKMKLLPRKSH
DNAQLVSGVYFQGTTIGMAPIMSMCTADQSGGIVMDHSDNPLGAAVTLAHELGHNFGMNH
DTLDRGCSCQMAVEKGGCIMNASTGYPFPMVFSSCSRKDLETSLEKGMGVCLFNLPEVRE
SFGGQKCGNRFVEEGEECDCGEPEECMNRCCNATTCTLKPDAVCAHGLCCEDCQLKPAGT
ACRDSSNSCDLPEFCTGASPHCPANVYLHDGHSCQDVDGYCYNGICQTHEQQCVTLWGPG
AKPAPGICFERVNSAGDPYGNCGKVSKSSFAKCEMRDAKCGKIQCQGGASRPVIGTNAVS
IETNIPLQQGGRILCRGTHVYLGDDMPDPGLVLAGTKCADGKICLNRQCQNISVFGVHEC
AMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQADNQGLTIGILVTILCL
LAAGFVVYLKRKTLIRLLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGHLGKGLMRKPP
DSYPPKDNPRRLLQCQNVDISRPLNGLNVPQPQSTQRVLPPLHRAPRAPSVPARPLPAKP
ALRQAQGTCKPNPPQKPLPADPLARTTRLTHALARTPGQWETGLRLAPLRPAPQYPHQVP
RSTHTAYIK
Download sequence
Identical sequences O43184
9606.ENSP00000357668 gi|73747885|ref|NP_003465.3| ENSP00000357668 ENSP00000357665 ENSP00000357668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]