SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O43255 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O43255
Domain Number 1 Region: 133-321
Classification Level Classification E-value
Superfamily TRAF domain-like 2.55e-61
Family SIAH, seven in absentia homolog 0.0000000107
Further Details:      
 
Domain Number 2 Region: 72-138
Classification Level Classification E-value
Superfamily RING/U-box 0.00000286
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O43255
Sequence length 324
Comment (sp|O43255|SIAH2_HUMAN) Seven in absentia homolog 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SIAH2; OC=Catarrhini; Hominidae; Homo.
Sequence
MSRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGG
GGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTP
SIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGS
LEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYE
GHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFD
TAIAHLFADNGNLGINVTISTCCP
Download sequence
Identical sequences A0A096MUM5 A0A0D9RGT6 A0A2K5C011 A0A2K5NBV9 A0A2K5RJJ1 A0A2K5WXA6 A0A2K6DXN3 F6TED2 F7I4Z0 G1QSY7 G3RFD5 H2PBR5 H2QNL0 O43255
ENSGGOP00000014299 ENSGGOP00000014299 ENSMMUP00000020449 9544.ENSMMUP00000020449 9598.ENSPTRP00000026742 9600.ENSPPYP00000015889 9606.ENSP00000322457 ENSPTRP00000026742 gi|31982899|ref|NP_005058.3| ENSP00000322457 ENSPPYP00000015889 ENSNLEP00000004055 NP_001181312.1.72884 NP_005058.3.87134 NP_005058.3.92137 XP_002759538.1.60252 XP_002814224.1.23681 XP_003256340.1.23891 XP_004037894.1.27298 XP_005546152.1.63531 XP_008006916.1.81039 XP_011709207.1.29376 XP_011941099.1.92194 XP_012292556.1.9421 XP_017378325.1.71028 XP_516819.2.37143 ENSP00000322457 ENSCJAP00000002021 ENSPPYP00000015889 O43255 ENSNLEP00000004055 ENSMMUP00000020449 ENSCJAP00000002023 ENSP00000322457 ENSPTRP00000026742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]