SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O43293 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O43293
Domain Number 1 Region: 6-313
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.71e-85
Family Protein kinases, catalytic subunit 0.00000000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O43293
Sequence length 454
Comment (sp|O43293|DAPK3_HUMAN) Zipper-interacting protein kinase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=DAPK3; OC=Catarrhini; Hominidae; Homo.
Sequence
MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE
IEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTT
RLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIY
EEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRY
EALAKQVASEMRFVQDLVRALEQEKLQGVECGLR
Download sequence
Identical sequences A0A2J8SBR2 G2HGB3 O43293
9598.ENSPTRP00000017483 9606.ENSP00000301264 ENSPTRP00000017483 ENSPTRP00000017483 ENSP00000301264 gi|4557511|ref|NP_001339.1| ENSP00000301264 ENSP00000442973 ENSP00000301264 ENSP00000442973 NP_001233503.1.37143 NP_001339.1.87134 NP_001339.1.92137 XP_005259565.1.92137 XP_016789511.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]