SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O43572 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O43572
Domain Number 1 Region: 112-172,293-376
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.23e-33
Family Regulator of G-protein signaling, RGS 0.0076
Further Details:      
 
Domain Number 2 Region: 371-510
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.12e-28
Family Regulator of G-protein signaling, RGS 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O43572
Sequence length 662
Comment (sp|O43572|AKA10_HUMAN) Protein kinase A-anchoring protein 10 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=AKAP10; OC=Catarrhini; Hominidae; Homo.
Sequence
MRGAGPSPRQSPRTLRPDPGPAMSFFRRKVKGKEQEKTSDVKSIKASISVHSPQKSTKNH
ALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEAAHFGDLGRSCLDYQTQETKS
SLSKTLEQVLHDTIVLPYFIQFMELRRMEHLVKFWLEAESFHSTTWSRIRAHSLNTVKQS
SLAEPVSPSKKHETTASFLTDSLDKRLEDSGSAQLFMTHSEGIDLNNRTNSTQNHLLLSQ
ECDSAHSLRLEMARAGTHQVSMETQESSSTLTVASRNSPASPLKELSGKLMKSIEQDAVN
TFTKYISPDAAKPIPITEAMRNDIIARICGEDGQVDPNCFVLAQSIVFSAMEQEHFSEFL
RSHHFCKYQIEVLTSGTVYLADILFCESALFYFSEYMEKEDAVNILQFWLAADNFQSQLA
AKKGQYDGQEAQNDAMILYDKYFSLQATHPLGFDDVVRLEIESNICREGGPLPNCFTTPL
RQAWTTMEKVFLPGFLSSNLYYKYLNDLIHSVRGDEFLGGNVSLTAPGSVGPPDESHPGS
SDSSASQSSVKKASIKILKNFDEAIIVDAASLDPESLYQRTYAGKMTFGRVSDLGQFIRE
SEPEPDVRKSKGSMFSQAMKKWVQGNTDEAQEELAWKIAKMIVSDIMQQAQYDQPLEKST
KL
Download sequence
Identical sequences A0A0S2Z4Z7 O43572
HR3352 ENSP00000225737 ENSP00000225737 gi|21493033|ref|NP_009133.2| NP_009133.2.87134 NP_009133.2.92137 9606.ENSP00000225737 ENSP00000225737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]