SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O43597 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O43597
Sequence length 315
Comment (sp|O43597|SPY2_HUMAN) Protein sprouty homolog 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SPRY2; OC=Catarrhini; Hominidae; Homo.
Sequence
MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPT
VVPRPGLKPAPRPSTQHKHERLHGLPEHRQPPRLQHSQVHSSARAPLSRSISTVSSGSRS
STRTSTSSSSSEQRLLGSSFSSGPVADGIIRVQPKSELKPGELKPLSKEDLGLHAYRCED
CGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTCVCCVKGLFYHCSNDDEDNCADN
PCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVC
CKVPTVPPRNFEKPT
Download sequence
Identical sequences A0A2K5JJH2 G7NJH1 G7PVK0 K7BHM1 O43597
ENSP00000366306 ENSP00000366308 ENSP00000439027 ENSP00000366306 ENSP00000366308 HR4509 ENSNLEP00000019982 9598.ENSPTRP00000010120 9606.ENSP00000366306 ENSPTRP00000010120 NP_001305465.1.87134 NP_001305465.1.92137 NP_001305466.1.87134 NP_001305466.1.92137 NP_001305467.1.87134 NP_001305467.1.92137 NP_005833.1.87134 NP_005833.1.92137 XP_001142950.1.37143 XP_001143108.1.37143 XP_003257417.1.23891 XP_003257418.1.23891 XP_003257419.1.23891 XP_003257420.1.23891 XP_003825303.1.60992 XP_003825304.1.60992 XP_003952460.1.37143 XP_004088199.1.23891 XP_005586130.1.63531 XP_005586131.1.63531 XP_005586132.1.63531 XP_010360138.1.97406 XP_011739696.1.29376 XP_011739697.1.29376 XP_011739698.1.29376 XP_011739699.1.29376 XP_011796055.1.43180 XP_011796056.1.43180 XP_011796057.1.43180 XP_011796058.1.43180 XP_011796059.1.43180 XP_011852681.1.47321 XP_011852682.1.47321 XP_011852683.1.47321 XP_011852684.1.47321 XP_011942054.1.92194 XP_011942055.1.92194 XP_011942056.1.92194 XP_011942057.1.92194 XP_011942058.1.92194 XP_012362312.1.23891 XP_014976784.1.72884 XP_014976785.1.72884 XP_014976786.1.72884 XP_017726715.1.44346 XP_017726716.1.44346 XP_017726717.1.44346 XP_017726718.1.44346 XP_529573.2.37143 ENSP00000366306 ENSNLEP00000019982 gi|5032115|ref|NP_005833.1| ENSPTRP00000010120 ENSPANP00000007746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]