SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O43612 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O43612
Sequence length 131
Comment (sp|O43612|OREX_HUMAN) Hypocretin-2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HCRT; OC=Catarrhini; Hominidae; Homo.
Sequence
MNLPSTKVSWAAVTLLLLLLLLPPALLSSGAAAQPLPDCCRQKTCSCRLYELLHGAGNHA
AGILTLGKRRSGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRPCLGRRCSAPAA
ASVAPGGQSGI
Download sequence
Identical sequences G3SG65 O43612
ENSGGOP00000027101 ENSGGOP00000015193 NP_001515.1.87134 NP_001515.1.92137 XP_003813923.1.60992 XP_004041760.1.27298 ENSP00000293330 9606.ENSP00000293330 ENSP00000293330 gi|4557635|ref|NP_001515.1| ENSP00000293330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]