SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O43612 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O43612
Sequence length 131
Comment (sp|O43612|OREX_HUMAN) Hypocretin-2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HCRT; OC=Catarrhini; Hominidae; Homo.
Sequence
MNLPSTKVSWAAVTLLLLLLLLPPALLSSGAAAQPLPDCCRQKTCSCRLYELLHGAGNHA
AGILTLGKRRSGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRPCLGRRCSAPAA
ASVAPGGQSGI
Download sequence
Identical sequences G3SG65 O43612
9606.ENSP00000293330 ENSGGOP00000027101 ENSP00000293330 ENSP00000293330 gi|4557635|ref|NP_001515.1| ENSGGOP00000015193 ENSP00000293330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]