SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O43699 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O43699
Domain Number 1 Region: 145-230
Classification Level Classification E-value
Superfamily Immunoglobulin 4.69e-19
Family I set domains 0.025
Further Details:      
 
Domain Number 2 Region: 33-141
Classification Level Classification E-value
Superfamily Immunoglobulin 6.01e-16
Family V set domains (antibody variable domain-like) 0.00023
Further Details:      
 
Domain Number 3 Region: 259-339
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000377
Family I set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O43699
Sequence length 453
Comment (sp|O43699|SIGL6_HUMAN) Obesity-binding protein 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SIGLEC6; OC=Catarrhini; Hominidae; Homo.
Sequence
MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVPCRLPTTLPAS
YYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYF
FRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIF
SWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSYAPQK
VAISIFQGNSAAFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISN
TGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVLGAVWGASITTLV
FLCVCFIFRVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISED
EQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK
Download sequence
Identical sequences A0A024R4K4 O43699
gi|193794821|ref|NP_001236.4| ENSP00000345907 NP_001236.4.87134 NP_001236.4.92137 ENSP00000401502 ENSP00000401502 9606.ENSP00000375675 NYSGRC-LECT-ENSP00000375675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]