SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O60829 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) O60829
Sequence length 102
Comment (sp|O60829|PAGE4_HUMAN) PAGE-1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PAGE4; OC=Catarrhini; Hominidae; Homo.
Sequence
MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVE
GDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP
Download sequence
Identical sequences H2QYM0 O60829
ENSP00000218068 ENSP00000365311 ENSP00000472606 ENSP00000472893 ENSPTRP00000037595 GO.40247 9606.ENSP00000218068 gi|5901986|ref|NP_008934.1| ENSP00000218068 ENSPTRP00000037595 ENSP00000218068 ENSP00000365311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]