SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O75083 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O75083
Domain Number 1 Region: 60-390
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 2.38e-60
Family Nitrous oxide reductase, N-terminal domain 0.025
Further Details:      
 
Domain Number 2 Region: 309-604
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.99e-46
Family WD40-repeat 0.0000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) O75083
Sequence length 606
Comment (sp|O75083|WDR1_HUMAN) NORI-1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=WDR1; OC=Catarrhini; Hominidae; Homo.
Sequence
MPYEIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDNPALADIYTEHAHQ
VVVAKYAPSGFYIASGDVSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVV
GEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQSRPYRLATGSDDNCAAFFEGPPFK
FKFTIGDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAI
SWSPDSTHLLSASGDKTSKIWDVSVNSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGY
INYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFA
GKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGY
AVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGTTLK
DEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHHAKIVCLAW
SPDNEHFASGGMDMMVYVWTLSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVK
EWTITY
Download sequence
Identical sequences O75083 V9HWG7
ENSP00000371889 ENSP00000371890 ENSP00000427687 ENSP00000371890 ENSP00000427687 gi|9257257|ref|NP_059830.1| Hs9257257___KOG0318 NP_059830.1.87134 NP_059830.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]