SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O75783 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O75783
Domain Number 1 Region: 193-396
Classification Level Classification E-value
Superfamily Rhomboid-like 2.35e-32
Family Rhomboid-like 0.0051
Further Details:      
 
Domain Number 2 Region: 77-134
Classification Level Classification E-value
Superfamily EF-hand 0.00000857
Family Calmodulin-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cell-cell junction 1.461 59.62
sarcolemma 1.691 53.74
actomyosin 2.172 47.35
actin filament bundle 1.881 45.18
cortical actin cytoskeleton 1.946 43.48
lateral plasma membrane 2.075 43.15
actin cytoskeleton 1.374 40.06
occluding junction 2.083 36.75
cell-cell adherens junction 2.009 35.78
cell-substrate junction 1.548 33.66
Biological Process IC (bits) H-Score
sarcomere organization 1.822 55.36
muscle fiber development 2.077 47.96
ERAD pathway 2.191 46.85
myotube differentiation 2.098 44.66
negative regulation of catabolic process 1.926 40.87
negative regulation of intracellular transport 1.951 40.87
regulation of wound healing 1.869 39.77
proteolysis 1.316 36.03
programmed cell death 1.494 32.79
mitochondrion organization 1.723 32.79

Protein sequence

External link(s) O75783
Sequence length 438
Comment (sp|O75783|RHBL1_HUMAN) Rhomboid-like protein 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RHBDL1; OC=Catarrhini; Hominidae; Homo.
Sequence
MGRVEDGGTTEELEDWDPGTSALPAPGIKQGPREQTGTGPLSQKCWEPEPDAPSQPGPAL
WSRGRARTQALAGGSSLQQLDPENTGFIGADTFTGLVHSHELPLDPAKLDMLVALAQSNE
QGQVCYQELVDLISSKRSSSFKRAIANGQRALPRDGPLDEPGLGVYKRFVRYVAYEILPC
EVDRRWYFYRHRSCPPPVFMASVTLAQIIVFLCYGARLNKWVLQTYHPEYMKSPLVYHPG
HRARAWRFLTYMFMHVGLEQLGFNALLQLMIGVPLEMVHGLLRISLLYLAGVLAGSLTVS
ITDMRAPVVGGSGGVYALCSAHLANVVMNWAGMRCPYKLLRMVLALVCMSSEVGRAVWLR
FSPPLPASGPQPSFMAHLAGAVVGVSMGLTILRSYEERLRDQCGWWVVLLAYGTFLLFAV
FWNVFAYDLLGAHIPPPP
Download sequence
Identical sequences O75783
ENSP00000344206 ENSP00000219551 ENSP00000219551 gi|4506525|ref|NP_003952.1| 9606.ENSP00000219551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]