SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O75840 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O75840
Domain Number 1 Region: 233-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000134
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 266-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000303
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O75840
Sequence length 302
Comment (sp|O75840|KLF7_HUMAN) Ubiquitous krueppel-like factor KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KLF7; OC=Catarrhini; Hominidae; Homo.
Sequence
MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDC
FLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLD
SYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGG
VATAAAAVTAAGAVKSGQSDSDQGGLGAEACPENKKRVHRCQFNGCRKVYTKSSHLKAHQ
RTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKR
HI
Download sequence
Identical sequences A0A024R3X8 A0A096NXV9 A0A0D9RCL3 A0A2I3RAR5 A0A2K5EWP8 A0A2K5HNJ2 A0A2K5NKE7 A0A2K5RRZ6 A0A2K5XC97 A0A2K6B622 A0A2K6MET9 A0A2K6QT27 G3R1P0 G7N8R7 G7PLA2 H2P8F1 O75840
ENSPPYP00000014657 ENSPTRP00000021975 ENSGGOP00000009121 ENSP00000309570 ENSP00000309570 ENSPANP00000017915 NP_003700.1.87134 NP_003700.1.92137 XP_001138873.3.37143 XP_002812828.1.23681 XP_005574138.1.63531 XP_007964209.1.81039 XP_007964210.1.81039 XP_009236315.1.23681 XP_009236316.1.23681 XP_010384376.1.97406 XP_010384377.1.97406 XP_011716195.1.29376 XP_011716196.1.29376 XP_011716197.1.29376 XP_011805241.1.43180 XP_011805242.1.43180 XP_011849274.1.47321 XP_011849276.1.47321 XP_011903087.1.92194 XP_011903088.1.92194 XP_011903089.1.92194 XP_012301468.1.9421 XP_014199534.1.60992 XP_016860650.1.92137 XP_017402179.1.71028 XP_017402180.1.71028 XP_017749421.1.44346 XP_017749422.1.44346 XP_017749423.1.44346 XP_017749424.1.44346 XP_018878105.1.27298 XP_018878106.1.27298 XP_018878107.1.27298 XP_018878108.1.27298 gi|4507829|ref|NP_003700.1| ENSPTRP00000021975 9598.ENSPTRP00000021975 9600.ENSPPYP00000014657 9606.ENSP00000309570 ENSPPYP00000014657 ENSP00000309570 ENSGGOP00000009121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]