SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O75840 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O75840
Domain Number 1 Region: 233-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000134
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 266-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000303
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
chromosomal part 1.512 6.38
nucleoplasm part 1.369 5.81
inclusion body 2.202 4.9
chromosomal region 1.996 4.81
cilium 1.675 4.6
ciliary part 1.819 4.6
ATPase complex 2.002 4.39
nucleolus 1.732 4
chromatin 1.876 3.95
intracellular ribonucleoprotein complex 1.368 3.78

Protein sequence

External link(s) O75840
Sequence length 302
Comment (sp|O75840|KLF7_HUMAN) Ubiquitous krueppel-like factor KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KLF7; OC=Catarrhini; Hominidae; Homo.
Sequence
MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDC
FLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLD
SYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGG
VATAAAAVTAAGAVKSGQSDSDQGGLGAEACPENKKRVHRCQFNGCRKVYTKSSHLKAHQ
RTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKR
HI
Download sequence
Identical sequences A0A024R3X8 A0A096NXV9 A0A0D9RCL3 G3R1P0 G7N8R7 G7PLA2 H2P8F1 H2QJA7 O75840
ENSP00000309570 ENSPPYP00000014657 ENSPPYP00000014657 ENSPTRP00000021975 ENSPANP00000017915 ENSP00000309570 9598.ENSPTRP00000021975 9600.ENSPPYP00000014657 9606.ENSP00000309570 gi|4507829|ref|NP_003700.1| ENSGGOP00000009121 ENSPTRP00000021975 ENSGGOP00000009121 ENSP00000309570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]