SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O75955 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O75955
Domain Number 1 Region: 32-175
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 1.18e-34
Family Band 7/SPFH domain 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) O75955
Sequence length 427
Comment (sp|O75955|FLOT1_HUMAN) Flotillin-1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FLOT1; OC=Catarrhini; Hominidae; Homo.
Sequence
MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHG
VPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEI
YKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGE
AEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQL
QVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEA
EKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEK
LPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVN
HKPLRTA
Download sequence
Identical sequences O75955 Q5ST80
GO.35458 HR3087 9606.ENSP00000365569 9606.ENSP00000372873 9606.ENSP00000373056 9606.ENSP00000388861 9606.ENSP00000391438 ENSP00000365569 ENSP00000372873 ENSP00000373056 ENSP00000388032 ENSP00000388861 ENSP00000365569 ENSP00000372873 ENSP00000373056 ENSP00000388861 ENSP00000391438 gi|5031699|ref|NP_005794.1| NP_005794.1.87134 NP_005794.1.92137 XP_005248837.1.92137 ENSP00000365569 ENSP00000372873 ENSP00000373056 ENSP00000388861 ENSP00000391438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]