SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O94766 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O94766
Domain Number 1 Region: 75-334
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 7.5e-99
Family 1,3-glucuronyltransferase 0.000000000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O94766
Sequence length 335
Comment (sp|O94766|B3GA3_HUMAN) UDP-GlcUA:Gal beta-1,3-Gal-R glucuronyltransferase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=B3GAT3; OC=Catarrhini; Hominidae; Homo.
Sequence
MKLKLKNVFLAYFLVSIAGLLYALVQLGQPCDCLPPLRAAAEQLRQKDLRISQLQAELRR
PPPAPAQPPEPEALPTIYVVTPTYARLVQKAELVRLSQTLSLVPRLHWLLVEDAEGPTPL
VSGLLAASGLLFTHLVVLTPKAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKD
PPPPGTQGVVYFADDDNTYSRELFEEMRWTRGVSVWPVGLVGGLRFEGPQVQDGRVVGFH
TAWEPSRPFPVDMAGFAVALPLLLDKPNAQFDSTAPRGHLESSLLSHLVDPKDLEPRAAN
CTRVLVWHTRTEKPKMKQEEQLQRQGRGSDPAIEV
Download sequence
Identical sequences O94766
ENSP00000265471 ENSP00000265471 gi|12408654|ref|NP_036332.2| ENSP00000265471 NP_036332.2.87134 NP_036332.2.92137 9606.ENSP00000265471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]